5Y30: LGI1 LRR domain

Crystal structure of LGI1 LRR domain. Determined by X-ray diffraction at 1.78 Å resolution. Released 2 May 2018.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,560
Mol. weight: 23.81 kDa
Released: 2 May 2018

Explore 5Y30 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Y30 contains 5 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	46-48	3	1
β-strand	52-56	5	1
β-strand	71-75	5	1
β-strand	81-82	2	2
β-strand	95-99	5	1
β-strand	102-103	2	3
β-strand	105-106	2	2
β-strand	119-123	5	1
β-strand	126-127	2	3
β-strand	130	1	2
β-strand	143-145	3	1
β-strand	167-169	3	1
β-strand	176	1	4
α-helix	179-181	3
α-helix	182-190	9
β-strand	194-195	2	1
β-strand	199	1	5
β-strand	202	1	4
α-helix	204-206	3
β-strand	210	1	5
α-helix	211-213	3
α-helix	216-218	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich glioma-inactivated protein 1	A	protein	210	Homo sapiens	O95970 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5Y30_1 Leucine-rich glioma-inactivated protein 1 (chains A)
DAAQPARRARRTYEAYPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFT
EISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKS
LIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYC
EGPPEYKKRKINSLSSKDFDCIIKHHHHHH

Primary citation

Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22. Yamagata, A., Miyazaki, Y., Yokoi, N. et al. Nat Commun (2018) 9:1546-1546. DOI 10.1038/s41467-018-03947-w · PubMed

Other PDB entries of the same protein (UniProt O95970 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5Y2Z 2.67 Å, Crystal structure of human LGI1 EPTP-ADAM22 complex
9KZC 2.78 Å, Cryo-EM structure of the LGI1 LRR-LGI1 EPTP-ADAM22 ECD complex
8HQ2 2.93 Å, Crystal structure of human ADAM22 in complex with human LGI1 mutant
8Y6B 3.49 Å, Structure of human LGI1-ADAM22 complex in space group P212121
9KZT 3.79 Å, Cryo-EM structure of the 3:3 LGI1-ADAM22 complex
8HQ1 4.17 Å, Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2
8HPY 5.87 Å, Crystal structure of human LGI1-ADAM22 complex
5Y31 7.13 Å, Crystal structure of human LGI1-ADAM22 complex

Browse structure collections

About this viewer

MolViewer shows 5Y30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.