8Y6B: Human LGI1-ADAM22 complex in space group P212121

Structure of human LGI1-ADAM22 complex in space group P212121. Determined by X-ray diffraction at 3.49 Å resolution. Released 14 Feb 2024.

Method: X-ray diffraction
Resolution: 3.49 Å
Organism: Homo sapiens
Chains: 6
Atoms: 24,226
Mol. weight: 347.54 kDa
Ligands: NAG, CA
Released: 14 Feb 2024

Explore 8Y6B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Y6B contains 83 α-helices and 224 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	239-247	9	1
α-helix	249-254	6
α-helix	259-281	23
β-strand	283-292	10	1
α-helix	305-318	14
β-strand	326-330	5	1
α-helix	334-335	2
β-strand	341-343	3	1
β-strand	355-358	4	1
α-helix	363-377	15
α-helix	385-389	5
α-helix	410-411	2
α-helix	416-427	12
α-helix	432-435	4
α-helix	436-438	3
α-helix	465-467	3
β-strand	474-475	2	2
β-strand	478-479	2	2
β-strand	491	1	3
β-strand	496	1	3
α-helix	497-498	2
β-strand	502-504	3	4
β-strand	511	1	5
α-helix	512-513	2
β-strand	514-515	2	4
α-helix	523-526	4
β-strand	528	1	5
β-strand	529	1	6
α-helix	530	1
β-strand	534-535	2	7
β-strand	540-543	4	7
β-strand	546-548	3	7
α-helix	550-558	9
β-strand	564	1	8
α-helix	565-566	2
α-helix	567-576	10
β-strand	585	1	9
β-strand	590	1	9
α-helix	591-594	4
α-helix	595-600	6
β-strand	602	1	10
β-strand	605	1	8
β-strand	616-628	13	8
β-strand	631-643	13	8
β-strand	646-648	3	8
β-strand	650	1	10
α-helix	651-652	2
β-strand	658	1	11
β-strand	661-664	4	11
β-strand	667-670	4	11
α-helix	671-674	4
α-helix	688-690	3
β-strand	692-694	3	12
β-strand	695	1	6
β-strand	700-702	3	12
β-strand	706-707	2	13
β-strand	713-714	2	13

Chain B: 23 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	239-247	9	24
α-helix	249-254	6
α-helix	259-281	23
β-strand	283-292	10	24
α-helix	305-318	14
β-strand	326-331	6	24
α-helix	334-335	2
β-strand	341-343	3	24
β-strand	355-359	5	24
α-helix	363-377	15
α-helix	384-389	6
α-helix	410-411	2
α-helix	416-427	12
α-helix	432-435	4
α-helix	437-438	2
α-helix	463-468	6
β-strand	474-475	2	25
β-strand	478-479	2	25
β-strand	491	1	26
β-strand	496	1	26
α-helix	497-498	2
β-strand	502-504	3	27
β-strand	511	1	28
α-helix	512-513	2
β-strand	514-515	2	27
α-helix	523-526	4
β-strand	528	1	28
β-strand	529	1	29
α-helix	530	1
β-strand	534-535	2	30
β-strand	540-543	4	30
β-strand	546-548	3	30
α-helix	550-558	9
β-strand	563-564	2	31
α-helix	565-566	2
α-helix	567-573	7
β-strand	585	1	32
β-strand	590	1	32
α-helix	591-594	4
α-helix	595-600	6
β-strand	602	1	33
β-strand	605-606	2	31
β-strand	616-628	13	31
β-strand	631-643	13	31
β-strand	646-648	3	31
β-strand	650	1	33
α-helix	651-652	2
β-strand	658	1	34
β-strand	661-664	4	34
β-strand	667-670	4	34
α-helix	671-674	4
α-helix	688-690	3
β-strand	692-694	3	35
β-strand	695	1	29
β-strand	700-702	3	35

Chain C: 24 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	239-247	9	36
α-helix	249-254	6
α-helix	259-281	23
β-strand	283-292	10	36
α-helix	305-318	14
β-strand	326-331	6	36
α-helix	334-335	2
β-strand	341-343	3	36
β-strand	356-359	4	36
α-helix	363-377	15
α-helix	384-389	6
α-helix	410-411	2
α-helix	416-427	12
α-helix	432-435	4
α-helix	437-438	2
α-helix	444-445	2
α-helix	470-472	3
β-strand	474-475	2	37
β-strand	478-479	2	37
β-strand	491-492	2	38
β-strand	495-496	2	38
α-helix	497-498	2
β-strand	502-504	3	39
β-strand	511	1	40
α-helix	512-513	2
β-strand	514-515	2	39
α-helix	523-526	4
β-strand	528	1	40
β-strand	529	1	41
α-helix	530	1
β-strand	534-535	2	42
β-strand	540-543	4	42
β-strand	546-548	3	42
α-helix	550-558	9
β-strand	563-564	2	43
α-helix	565-566	2
α-helix	567-576	10
β-strand	584-585	2	44
β-strand	590-591	2	44
α-helix	592-594	3
α-helix	598-600	3
β-strand	602	1	45
β-strand	605-606	2	43
β-strand	616-628	13	43
β-strand	631-641	11	43
β-strand	647-648	2	43
β-strand	650	1	45
α-helix	651-652	2
β-strand	658	1	46
β-strand	661-664	4	46
β-strand	667-670	4	46
α-helix	671-674	4
α-helix	688-690	3
β-strand	692-694	3	47
β-strand	695	1	41
β-strand	700-702	3	47
β-strand	706-707	2	48
β-strand	713-714	2	48

Chain D: 3 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	46-48	3	14
β-strand	52-56	5	14
β-strand	71-75	5	14
α-helix	82-83	2
β-strand	95-99	5	14
β-strand	102-106	5	15
β-strand	119-122	4	14
β-strand	126-130	5	15
β-strand	144-145	2	14
β-strand	167-169	3	14
β-strand	175-176	2	16
α-helix	179-190	12
β-strand	194-195	2	14
β-strand	199-202	4	16
β-strand	209-210	2	16
α-helix	211-213	3
β-strand	222-231	10	17
β-strand	238-244	7	18
β-strand	247-254	8	18
β-strand	259-264	6	18
β-strand	273-279	7	18
β-strand	283-290	8	19
β-strand	295-301	7	19
β-strand	307-311	5	19
β-strand	318-322	5	19
β-strand	332-339	8	20
β-strand	344-350	7	20
β-strand	357-362	6	20
β-strand	367-373	7	20
β-strand	379-388	10	21
β-strand	395-403	9	21
β-strand	409-414	6	21
β-strand	419-425	7	21
β-strand	432-440	9	22
β-strand	443-450	8	22
β-strand	452-460	9	22
β-strand	465-474	10	22
β-strand	479-484	6	23
β-strand	487-492	6	23
β-strand	499-505	7	23
β-strand	510-517	8	23
β-strand	525-530	6	17
β-strand	533-538	6	17
β-strand	546-554	9	17

Chain E: 5 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	46-49	4	59
β-strand	52-56	5	59
β-strand	71-75	5	59
α-helix	82-83	2
β-strand	95-99	5	59
β-strand	102-106	5	60
β-strand	119-123	5	59
β-strand	126-130	5	60
β-strand	143-145	3	59
β-strand	167-169	3	59
β-strand	176	1	61
α-helix	179-181	3
α-helix	182-190	9
β-strand	194-195	2	59
β-strand	199-200	2	62
β-strand	202	1	61
β-strand	209-210	2	62
α-helix	211-213	3
β-strand	222-232	11	63
β-strand	239-244	6	64
β-strand	247-254	8	64
β-strand	259-266	8	64
β-strand	271-279	9	64
β-strand	283-290	8	65
β-strand	295-301	7	65
β-strand	307-311	5	65
β-strand	318-323	6	65
β-strand	332-339	8	66
β-strand	344-350	7	66
β-strand	357-362	6	66
β-strand	367-373	7	66
β-strand	379-388	10	67
β-strand	395-403	9	67
β-strand	409-414	6	67
β-strand	419-425	7	67
β-strand	435-439	5	68
β-strand	444-448	5	68
β-strand	452-460	9	68
β-strand	465-474	10	68
β-strand	479-483	5	69
β-strand	488-492	5	69
α-helix	498	1
β-strand	499-505	7	69
β-strand	510-517	8	69
β-strand	525-530	6	63
β-strand	533-538	6	63
β-strand	545-554	10	63

Chain F: 5 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	46-48	3	49
β-strand	52-56	5	49
β-strand	71-75	5	49
α-helix	82-83	2
β-strand	95-99	5	49
β-strand	102-103	2	50
β-strand	119-123	5	49
β-strand	126-127	2	50
β-strand	143-145	3	49
β-strand	167-169	3	49
β-strand	175-176	2	51
α-helix	179-181	3
α-helix	182-190	9
β-strand	194-195	2	49
β-strand	199-202	4	51
β-strand	209-210	2	51
α-helix	216-218	3
β-strand	222-232	11	52
β-strand	238-243	6	53
β-strand	248-254	7	53
β-strand	259-265	7	53
β-strand	272-279	8	53
β-strand	283-290	8	54
β-strand	295-301	7	54
β-strand	307-312	6	54
β-strand	317-323	7	54
β-strand	332-339	8	55
β-strand	344-350	7	55
β-strand	357-362	6	55
β-strand	367-373	7	55
β-strand	379-388	10	56
β-strand	395-403	9	56
β-strand	409-414	6	56
β-strand	419-425	7	56
β-strand	432-440	9	57
β-strand	443-450	8	57
β-strand	452-460	9	57
β-strand	465-474	10	57
β-strand	479-484	6	58
β-strand	487-492	6	58
α-helix	498	1
β-strand	499-505	7	58
β-strand	510-517	8	58
β-strand	525-530	6	52
β-strand	533-538	6	52
β-strand	545-554	10	52

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disintegrin and metalloproteinase domain-containing protein 22	A, B, C	protein	486	Homo sapiens	Q9P0K1 (AlphaFold model)
Leucine-rich glioma-inactivated protein 1	D, E, F	protein	526	Homo sapiens	O95970 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8Y6B_1 Disintegrin and metalloproteinase domain-containing protein 22 (chains A, B, C)
NVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMET
WATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLL
KGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPK
KFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAE
CCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDG
YSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQ
CNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVE
DGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCN
TYFPHN

Sequence of entity 2 (D, E, F), FASTA

>8Y6B_2 Leucine-rich glioma-inactivated protein 1 (chains D, E, F)
HHHHHHHKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTP
SLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNL
QTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKI
NSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKT
FRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRK
PNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTP
QTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRF
IGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKF
VKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	18
CA	Calcium ion	Ca	12

Primary citation

Structure of human LGI1-ADAM22 complex in space group P212121. Liu, H., Xu, F. To be published.

Other PDB entries of the same protein (UniProt Q9P0K1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CQF 1.8 Å, Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide
3G5C 2.36 Å, Structural and biochemical studies on the ectodomain of human ADAM22
5Y2Z 2.67 Å, Crystal structure of human LGI1 EPTP-ADAM22 complex
9KZC 2.78 Å, Cryo-EM structure of the LGI1 LRR-LGI1 EPTP-ADAM22 ECD complex
8HQ2 2.93 Å, Crystal structure of human ADAM22 in complex with human LGI1 mutant
9KZT 3.79 Å, Cryo-EM structure of the 3:3 LGI1-ADAM22 complex
8HQ1 4.17 Å, Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2
8HPY 5.87 Å, Crystal structure of human LGI1-ADAM22 complex
5Y31 7.13 Å, Crystal structure of human LGI1-ADAM22 complex

Browse structure collections

About this viewer

MolViewer shows 8Y6B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.