9KZC: LGI1 LRR-LGI1 EPTP-ADAM22 ECD complex

Cryo-EM structure of the LGI1 LRR-LGI1 EPTP-ADAM22 ECD complex. Determined by electron microscopy at 2.78 Å resolution. Released 25 Jun 2025.

Method: Electron microscopy
Resolution: 2.78 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,846
Mol. weight: 179.04 kDa
Ligands: CA
Released: 25 Jun 2025

Explore 9KZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KZC contains 26 α-helices and 71 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	238	1
β-strand	239-247	9	1
α-helix	249-254	6
α-helix	259-280	22
β-strand	283-292	10	1
α-helix	300-302	3
α-helix	305-318	14
β-strand	326-331	6	1
β-strand	341-343	3	1
β-strand	355-359	5	1
α-helix	363-377	15
α-helix	384-389	6
α-helix	416-427	12
α-helix	432-435	4
α-helix	437-438	2
α-helix	444-445	2
α-helix	463-466	4
β-strand	474-475	2	2
β-strand	478-479	2	2
β-strand	491-492	2	3
β-strand	495-496	2	3
α-helix	497-498	2
β-strand	502-504	3	4
β-strand	511	1	5
β-strand	514-515	2	4
α-helix	523-525	3
β-strand	528	1	5
β-strand	529	1	6
β-strand	534-535	2	7
β-strand	540-543	4	7
β-strand	546-548	3	7
α-helix	550-557	8
β-strand	563-564	2	8
α-helix	565-566	2
α-helix	567-573	7
β-strand	602	1	9
β-strand	605-606	2	8
β-strand	617	1	10
β-strand	622-624	3	8
β-strand	635-637	3	8
β-strand	640	1	10
β-strand	650	1	9
α-helix	651-652	2
β-strand	656-658	3	11
β-strand	661-663	3	11
β-strand	668-670	3	11
α-helix	671-674	4
β-strand	693-694	2	12
β-strand	695	1	6
β-strand	700-701	2	12

Chain B: 1 helix, 28 β-strands

Element	Residues	Length	Sheet
β-strand	226-232	7	13
β-strand	239-243	5	14
β-strand	248-254	7	14
β-strand	259-265	7	14
β-strand	272-279	8	14
β-strand	283-290	8	15
β-strand	295-301	7	15
β-strand	307-312	6	15
β-strand	317-323	7	15
β-strand	332-339	8	16
β-strand	344-350	7	16
β-strand	358-362	5	16
β-strand	367-372	6	16
β-strand	379-387	9	17
β-strand	396-403	8	17
β-strand	409-414	6	17
β-strand	419-425	7	17
β-strand	434-440	7	18
β-strand	443-449	7	18
β-strand	452-460	9	18
β-strand	465-474	10	18
β-strand	479-484	6	19
β-strand	487-492	6	19
α-helix	498	1
β-strand	499-505	7	19
β-strand	510-517	8	19
β-strand	522-530	9	13
β-strand	533-540	8	13
β-strand	545-550	6	13

Chain D: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	46	1	20
β-strand	53-56	4	20
β-strand	71-75	5	20
α-helix	82-83	2
β-strand	95-99	5	20
β-strand	102-106	5	21
α-helix	107	1
β-strand	119-122	4	20
β-strand	126-130	5	21
β-strand	143-145	3	20
β-strand	167-169	3	20
α-helix	179-181	3
α-helix	182-190	9
β-strand	194-195	2	20
β-strand	199	1	22
α-helix	204-206	3
β-strand	210	1	22
α-helix	211-213	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disintegrin and metalloproteinase domain-containing protein 22	A	protein	486	Homo sapiens	Q9P0K1 (AlphaFold model)
Leucine-rich glioma-inactivated protein 1	B, D	protein	544	Homo sapiens	O95970 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9KZC_1 Disintegrin and metalloproteinase domain-containing protein 22 (chains A)
NVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMET
WATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLL
KGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPK
KFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAE
CCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDG
YSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQ
CNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVE
DGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCN
TYFPHN

Sequence of entity 2 (B, D), FASTA

>9KZC_2 Leucine-rich glioma-inactivated protein 1 (chains B, D)
DAAQPARRARRTYEAYPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFT
EISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKS
LIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYC
EGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKC
IFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIK
IQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDT
DVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSV
KGDVYICLTRFIGDSKVMKWGGSSFQDIQAMPSRGSMVFQPLQINNYQYAILGSDYSFTQ
VYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSAKHH
HHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Structural insights into heterohexameric assembly of epilepsy-related ligand-receptor complex LGI1-ADAM22. Yamaguchi, T., Okatsu, K., Kubota, M. et al. Elife (2025) 14. DOI 10.7554/eLife.105918 · PubMed

Other PDB entries of the same protein (UniProt Q9P0K1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CQF 1.8 Å, Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide
3G5C 2.36 Å, Structural and biochemical studies on the ectodomain of human ADAM22
5Y2Z 2.67 Å, Crystal structure of human LGI1 EPTP-ADAM22 complex
8HQ2 2.93 Å, Crystal structure of human ADAM22 in complex with human LGI1 mutant
8Y6B 3.49 Å, Structure of human LGI1-ADAM22 complex in space group P212121
9KZT 3.79 Å, Cryo-EM structure of the 3:3 LGI1-ADAM22 complex
8HQ1 4.17 Å, Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2
8HPY 5.87 Å, Crystal structure of human LGI1-ADAM22 complex
5Y31 7.13 Å, Crystal structure of human LGI1-ADAM22 complex

Browse structure collections

About this viewer

MolViewer shows 9KZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.