8HQ1: Human Lgi1-Adam22 Complex In Space Group C2

Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2. Determined by X-ray diffraction at 4.17 Å resolution. Released 13 Dec 2023.

Method: X-ray diffraction
Resolution: 4.17 Å
Organism: Homo sapiens
Chains: 6
Atoms: 23,997
Mol. weight: 347.54 kDa
Ligands: NAG, CA
Released: 13 Dec 2023

Explore 8HQ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HQ1 contains 80 α-helices and 237 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	238	1
β-strand	239-247	9	1
α-helix	249-254	6
α-helix	259-280	22
β-strand	283-292	10	1
α-helix	305-318	14
β-strand	326-331	6	1
β-strand	341-343	3	1
β-strand	356-359	4	1
α-helix	363-378	16
α-helix	384-389	6
α-helix	405-406	2
α-helix	416-427	12
α-helix	432-435	4
α-helix	436-438	3
α-helix	463-466	4
β-strand	474-475	2	2
β-strand	478-479	2	2
β-strand	491	1	3
β-strand	496	1	3
α-helix	497-498	2
β-strand	502-504	3	4
β-strand	511	1	5
β-strand	514-515	2	4
α-helix	523-526	4
β-strand	528	1	5
β-strand	529	1	6
α-helix	530	1
β-strand	534-535	2	7
β-strand	540-543	4	7
β-strand	546-548	3	7
α-helix	550-558	9
β-strand	564	1	8
α-helix	565-566	2
α-helix	567-576	10
β-strand	578	1	9
β-strand	581	1	9
β-strand	585	1	10
β-strand	590	1	10
α-helix	591-594	4
β-strand	602	1	8
β-strand	605	1	8
β-strand	616-628	13	8
β-strand	631-641	11	8
β-strand	647-648	2	8
β-strand	650	1	8
α-helix	651-652	2
β-strand	656-658	3	11
β-strand	661-664	4	11
β-strand	667-670	4	11
α-helix	671-674	4
α-helix	688-690	3
β-strand	692-694	3	12
β-strand	695	1	6
β-strand	700-702	3	12
β-strand	706-707	2	13
β-strand	713-714	2	13

Chain B: 22 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	238	1
β-strand	239-247	9	14
α-helix	249-254	6
α-helix	259-280	22
β-strand	283-292	10	14
α-helix	305-318	14
β-strand	326-331	6	14
β-strand	341-343	3	14
β-strand	355-359	5	14
α-helix	363-378	16
α-helix	384-389	6
α-helix	405-406	2
α-helix	410-411	2
α-helix	416-427	12
α-helix	432-435	4
α-helix	437-438	2
α-helix	463-466	4
β-strand	474-475	2	15
β-strand	478-479	2	15
β-strand	491	1	16
β-strand	496	1	16
α-helix	497-498	2
β-strand	502-504	3	17
β-strand	511	1	18
β-strand	514-515	2	17
α-helix	523-526	4
β-strand	528	1	18
β-strand	529	1	19
α-helix	530	1
β-strand	534-535	2	20
β-strand	540-543	4	20
β-strand	546-548	3	20
α-helix	550-558	9
β-strand	564	1	21
α-helix	565-566	2
α-helix	567-576	10
β-strand	578	1	22
β-strand	581	1	22
β-strand	585	1	23
β-strand	590	1	23
α-helix	591-594	4
β-strand	602	1	21
β-strand	605	1	21
β-strand	616-628	13	21
β-strand	631-641	11	21
β-strand	647-648	2	21
β-strand	650	1	21
α-helix	651-652	2
β-strand	656-658	3	24
β-strand	661-664	4	24
β-strand	667-670	4	24
α-helix	671-674	4
α-helix	688-690	3
β-strand	692-694	3	25
β-strand	695	1	19
β-strand	700-702	3	25
β-strand	706-707	2	26
β-strand	713-714	2	26

Chain C: 22 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	238	1
β-strand	239-247	9	27
α-helix	249-254	6
α-helix	259-280	22
β-strand	283-292	10	27
α-helix	305-318	14
β-strand	326-331	6	27
β-strand	341-343	3	27
β-strand	356-359	4	27
α-helix	363-378	16
α-helix	384-389	6
α-helix	405-406	2
α-helix	410-411	2
α-helix	416-427	12
α-helix	432-435	4
α-helix	437-438	2
α-helix	463-466	4
β-strand	474-475	2	28
β-strand	478-479	2	28
β-strand	491	1	29
β-strand	496	1	29
α-helix	497-498	2
β-strand	502-504	3	30
β-strand	511	1	31
β-strand	514-515	2	30
α-helix	523-526	4
β-strand	528	1	31
β-strand	529	1	32
α-helix	530	1
β-strand	534-535	2	33
β-strand	540-543	4	33
β-strand	546-548	3	33
α-helix	550-558	9
β-strand	564	1	34
α-helix	565-566	2
α-helix	567-576	10
β-strand	578	1	35
β-strand	581	1	35
β-strand	585	1	36
β-strand	590	1	36
α-helix	591-594	4
β-strand	602	1	34
β-strand	605	1	34
β-strand	616-628	13	34
β-strand	631-641	11	34
β-strand	647-648	2	34
β-strand	650	1	34
α-helix	651-652	2
β-strand	656-658	3	37
β-strand	661-664	4	37
β-strand	667-670	4	37
α-helix	671-674	4
α-helix	688-690	3
β-strand	692-694	3	38
β-strand	695	1	32
β-strand	700-702	3	38
β-strand	706-707	2	39
β-strand	713-714	2	39

Chain D: 4 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	46-48	3	40
β-strand	52-56	5	40
α-helix	65-66	2
β-strand	71-75	5	40
β-strand	82	1	41
β-strand	95-99	5	40
β-strand	102-106	5	41
β-strand	119-123	5	40
β-strand	126-130	5	41
β-strand	143-145	3	40
β-strand	167-169	3	40
β-strand	175-176	2	42
α-helix	179-181	3
α-helix	182-190	9
β-strand	194-195	2	40
β-strand	199	1	43
β-strand	200-202	3	42
β-strand	210	1	43
α-helix	216-219	4
β-strand	223-232	10	44
β-strand	238-244	7	45
β-strand	247-253	7	45
β-strand	260-265	6	45
β-strand	272-278	7	45
β-strand	283-291	9	46
β-strand	294-301	8	46
β-strand	307-312	6	46
β-strand	317-323	7	46
β-strand	332-339	8	47
β-strand	344-350	7	47
β-strand	357-362	6	47
β-strand	367-373	7	47
β-strand	379-388	10	48
β-strand	395-403	9	48
β-strand	409-414	6	48
β-strand	419-425	7	48
β-strand	432-440	9	49
β-strand	443-450	8	49
β-strand	454-460	7	49
β-strand	465-472	8	49
β-strand	479-484	6	50
β-strand	487-492	6	50
β-strand	499-505	7	50
β-strand	510-517	8	50
β-strand	525-529	5	44
β-strand	534-538	5	44
β-strand	545-553	9	44

Chain E: 5 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	46-48	3	51
β-strand	52-56	5	51
α-helix	65-66	2
β-strand	71-75	5	51
β-strand	81-82	2	52
β-strand	95-99	5	51
β-strand	102-106	5	52
β-strand	119-123	5	51
β-strand	126-130	5	52
β-strand	143-145	3	51
β-strand	167-169	3	51
β-strand	175-176	2	53
α-helix	179-181	3
α-helix	182-190	9
β-strand	194-195	2	51
β-strand	199	1	54
β-strand	200-202	3	53
β-strand	210	1	54
α-helix	216-219	4
β-strand	223-232	10	55
β-strand	238-244	7	56
β-strand	247-253	7	56
β-strand	260-264	5	56
β-strand	273-278	6	56
β-strand	283-291	9	57
β-strand	294-301	8	57
β-strand	307-311	5	57
β-strand	318-323	6	57
β-strand	332-339	8	58
β-strand	344-350	7	58
β-strand	357-362	6	58
β-strand	367-373	7	58
β-strand	379-388	10	59
β-strand	395-403	9	59
β-strand	409-414	6	59
β-strand	419-425	7	59
α-helix	426	1
β-strand	432-440	9	60
β-strand	443-450	8	60
β-strand	454-460	7	60
β-strand	465-472	8	60
β-strand	479-484	6	61
β-strand	487-492	6	61
β-strand	499-505	7	61
β-strand	510-517	8	61
β-strand	525-529	5	55
β-strand	534-538	5	55
β-strand	545-553	9	55

Chain F: 6 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	46-48	3	62
β-strand	52-56	5	62
α-helix	65-66	2
β-strand	71-75	5	62
β-strand	81-82	2	63
β-strand	95-99	5	62
β-strand	102-106	5	63
β-strand	119-123	5	62
β-strand	126-130	5	63
β-strand	143-145	3	62
β-strand	167-169	3	62
β-strand	175-176	2	64
α-helix	179-181	3
α-helix	182-190	9
β-strand	194-195	2	62
β-strand	199	1	65
β-strand	200-202	3	64
β-strand	210	1	65
α-helix	216-219	4
β-strand	222-232	11	66
β-strand	238-244	7	67
β-strand	247-253	7	67
β-strand	260-265	6	67
β-strand	272-278	7	67
β-strand	283-291	9	68
β-strand	294-301	8	68
β-strand	307-312	6	68
β-strand	317-323	7	68
β-strand	332-339	8	69
β-strand	344-350	7	69
α-helix	356	1
β-strand	357-362	6	69
β-strand	367-373	7	69
β-strand	379-388	10	70
β-strand	395-403	9	70
β-strand	409-414	6	70
β-strand	419-425	7	70
α-helix	426	1
β-strand	432-440	9	71
β-strand	443-450	8	71
β-strand	454-460	7	71
β-strand	465-472	8	71
β-strand	479-484	6	72
β-strand	487-492	6	72
β-strand	499-505	7	72
β-strand	510-517	8	72
β-strand	525-529	5	66
β-strand	534-538	5	66
β-strand	545-554	10	66

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disintegrin and metalloproteinase domain-containing protein 22	A, B, C	protein	486	Homo sapiens	Q9P0K1 (AlphaFold model)
Leucine-rich glioma-inactivated protein 1	D, E, F	protein	526	Homo sapiens	O95970 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8HQ1_1 Disintegrin and metalloproteinase domain-containing protein 22 (chains A, B, C)
NVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMET
WATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLL
KGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPK
KFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAE
CCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDG
YSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQ
CNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVE
DGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCN
TYFPHN

Sequence of entity 2 (D, E, F), FASTA

>8HQ1_2 Leucine-rich glioma-inactivated protein 1 (chains D, E, F)
HHHHHHHKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTP
SLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNL
QTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKI
NSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKT
FRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRK
PNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTP
QTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRF
IGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKF
VKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	18
CA	Calcium ion	Ca	12

Primary citation

Structure Of Human Lgi1-Adam22 Complex In Space Group C2. Liu, H.L., Lin, Z.H., Xu, F. To be published.

Other PDB entries of the same protein (UniProt Q9P0K1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CQF 1.8 Å, Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide
3G5C 2.36 Å, Structural and biochemical studies on the ectodomain of human ADAM22
5Y2Z 2.67 Å, Crystal structure of human LGI1 EPTP-ADAM22 complex
9KZC 2.78 Å, Cryo-EM structure of the LGI1 LRR-LGI1 EPTP-ADAM22 ECD complex
8HQ2 2.93 Å, Crystal structure of human ADAM22 in complex with human LGI1 mutant
8Y6B 3.49 Å, Structure of human LGI1-ADAM22 complex in space group P212121
9KZT 3.79 Å, Cryo-EM structure of the 3:3 LGI1-ADAM22 complex
8HPY 5.87 Å, Crystal structure of human LGI1-ADAM22 complex
5Y31 7.13 Å, Crystal structure of human LGI1-ADAM22 complex

Browse structure collections

About this viewer

MolViewer shows 8HQ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.