5YCA: Inner membrane protein Bqt4

Name: PDB 5YCA: Crystal structure of inner membrane protein Bqt4 in complex with LEM2
Published: 2018-11-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Crystal structure of inner membrane protein Bqt4 in complex with LEM2. Determined by X-ray diffraction at 1.57 Å resolution. Released 14 Nov 2018.

Method: X-ray diffraction
Resolution: 1.57 Å
Organisms: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 2
Atoms: 2,077
Mol. weight: 25.94 kDa
Released: 14 Nov 2018

Explore 5YCA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YCA contains 12 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	1
β-strand	22-28	7	1
α-helix	34-44	11
α-helix	48-50	3
β-strand	51-55	5	1
β-strand	58-59	2	1
α-helix	60-61	2
α-helix	66-69	4
β-strand	75-81	7	1
α-helix	82	1
α-helix	89-91	3
α-helix	99-104	6
β-strand	106-113	8	2
β-strand	115-125	11	2
β-strand	132-138	7	2
β-strand	144-145	2	2
α-helix	146-153	8
α-helix	159-172	14
β-strand	176	1	2
β-strand	185-186	2	2
α-helix	188-198	11
α-helix	201-209	9

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein SMT3,Bouquet formation protein 4	A	protein	207	Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O60158 (AlphaFold model), Q12306 (AlphaFold model)
Lap-Emerin-Man domain protein 2	C	protein	20	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	Q10109 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YCA_1 Ubiquitin-like protein SMT3,Bouquet formation protein 4 (chains A)
GPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIEADQTP
EDLDMEDNDIIEAHRSLPAERNPLYKDDTLDHTPLIPKCRAQVIEFPDGPATFVRLKCTN
PESKVPHFLMRMAKDSSISATSMFRSAFPKATQEEEDLEMRWIRDNLNPIEDKRVAGLWV
PPADALALAKDYSMTPFINALLEASST

Sequence of entity 2 (C), FASTA

>5YCA_2 Lap-Emerin-Man domain protein 2 (chains C)
GSAEEDDELFQNYVLQQTRK

Primary citation

Structural insights into chromosome attachment to the nuclear envelope by an inner nuclear membrane protein Bqt4 in fission yeast. Hu, C., Inoue, H., Sun, W. et al. Nucleic Acids Res (2019) 47:1573-1584. DOI 10.1093/nar/gky1186 · PubMed

Other PDB entries of the same protein (UniProt O60158 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YBX 2.5 Å, Crystal structure of the N-terminal domain of Bqt4 in S.pombe
6A6W 2.6 Å, Crystal structure of fission yeast inner membrane protein Bqt4 in complex with Sad1
5YC2 2.7 Å, Crystal structure of inner membrane protein Bqt4 in complex with telomeric protein Rap1

Browse structure collections

About this viewer

MolViewer shows 5YCA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.