5YQZ: Glucagon receptor

Structure of the glucagon receptor in complex with a glucagon analogue. Determined by X-ray diffraction at 3.0 Å resolution. Released 17 Jan 2018.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 2
Atoms: 4,710
Mol. weight: 72.23 kDa
Ligands: PO4, OLC
Released: 17 Jan 2018

Explore 5YQZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YQZ contains 34 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-28	26

Chain R: 33 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	28-48	21
α-helix	51-53	3
β-strand	57-58	2	1
β-strand	61-62	2	2
β-strand	67-68	2	2
β-strand	71-72	2	1
α-helix	75	1
β-strand	76-80	5	3
α-helix	88-91	4
β-strand	95-99	5	3
β-strand	100	1	4
α-helix	101	1
β-strand	106	1	4
β-strand	108	1	5
β-strand	114	1	5
β-strand	117	1	3
α-helix	119-121	3
α-helix	125-165	41
α-helix	168-170	3
α-helix	172-202	31
α-helix	209-216	8
α-helix	221-254	34
α-helix	1002-1006	5
α-helix	1007-1011	5
β-strand	1017-1018	2	6
β-strand	1024-1026	3	6
β-strand	1030-1033	4	6
α-helix	1038-1049	12
α-helix	1059-1079	21
α-helix	1084-1088	5
α-helix	1092-1104	13
α-helix	1107-1110	4
α-helix	1114-1121	8
α-helix	1125-1132	8
α-helix	1136-1140	5
α-helix	1142-1154	13
α-helix	1157-1160	4
α-helix	264-268	5
α-helix	269-273	5
α-helix	274-289	16
α-helix	305-334	30
α-helix	343-368	26
α-helix	376-390	15
α-helix	392-397	6
α-helix	398-402	5
α-helix	405-420	16
α-helix	421-425	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucagon receptor,Endolysin,Glucagon receptor	R	protein	575	Homo sapiens, Enterobacteria phage T4	P00720, P47871 (AlphaFold model)
Glucagon analogue	P	protein	28	Homo sapiens	P01275 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>5YQZ_1 Glucagon receptor,Endolysin,Glucagon receptor (chains R)
GAPQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPW
YLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQV
MYTVGYSLSLGALLLALAILGGLSKLHCTANAIHANLFASFVLKASSVLVIDGLLRTRYS
QKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATNIFEML
RIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLF
NQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWD
EAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYERSFFSLYLGIGWGAPMLFVVPWAVV
KCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKF
RLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNK
EVQSELRRRWHRWRLGKVLWEERNTSNEFLEVLFQ

Sequence of entity 2 (P), FASTA

>5YQZ_2 Glucagon analogue (chains P)
SQGTFTSEYSKYLDSRRAQDFVKWLLNT

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	6

Primary citation

Structure of the glucagon receptor in complex with a glucagon analogue. Zhang, H., Qiao, A., Yang, L. et al. Nature (2018) 553:106-110. DOI 10.1038/nature25153 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 5YQZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.