5YYA: Tandem Tudor Domain of human UHRF1

Crystal structure of Tandem Tudor Domain of human UHRF1. Determined by X-ray diffraction at 1.7 Å resolution. Released 12 Dec 2018.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,596
Mol. weight: 19.5 kDa
Released: 12 Dec 2018

Explore 5YYA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YYA contains 7 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	127-128	2	1
β-strand	140-144	5	1
β-strand	150-161	12	1
α-helix	162-165	4
α-helix	179-181	3
β-strand	183-188	6	1
α-helix	192-194	3
β-strand	196-200	5	1
α-helix	201-203	3
β-strand	204-205	2	1
α-helix	206-208	3
β-strand	211	1	1
α-helix	214-216	3
β-strand	222-227	6	1
β-strand	237-248	12	1
β-strand	253-260	8	1
β-strand	265-271	7	1
β-strand	278	1	1
α-helix	279-281	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A	protein	164	Homo sapiens	Q96T88 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YYA_1 E3 ubiquitin-protein ligase UHRF1 (chains A)
SDEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEED
VIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDA
EISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE

Primary citation

Structure of the UHRF1 Tandem Tudor Domain Bound to a Methylated Non-histone Protein, LIG1, Reveals Rules for Binding and Regulation. Kori, S., Ferry, L., Matano, S. et al. Structure (2019) 27:485. DOI 10.1016/j.str.2018.11.012 · PubMed

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W92 1.3 Å, Human UHRF1 TTD domain
6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
3ZVZ 1.45 Å, PHD finger of human UHRF1
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
3BI7 1.7 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1
3SHB 1.8 Å, Crystal Structure of PHD Domain of UHRF1

Browse structure collections

About this viewer

MolViewer shows 5YYA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.