5Z7G: TAX1BP1 SKICH region

Crystal structure of TAX1BP1 SKICH region in complex with NAP1. Determined by X-ray diffraction at 2.3 Å resolution. Released 2 Jan 2019.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,656
Mol. weight: 38.67 kDa
Released: 2 Jan 2019

Explore 5Z7G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Z7G contains 10 α-helices and 19 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	17-20	4	1
β-strand	25-26	2	2
β-strand	32-38	7	1
β-strand	49-54	6	2
β-strand	63-68	6	2
α-helix	69-72	4
β-strand	81-87	7	1
α-helix	89-91	3
β-strand	99-105	7	2
β-strand	111-114	4	2
α-helix	115-117	3
β-strand	118-120	3	2

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	17-19	3	3
β-strand	25-26	2	4
β-strand	32-38	7	3
β-strand	49-54	6	5
α-helix	60-62	3
β-strand	63-68	6	5
α-helix	70-72	3
α-helix	75-76	2
β-strand	81-87	7	3
β-strand	100-105	6	5
β-strand	111-114	4	5
α-helix	115-117	3
β-strand	118	1	5
β-strand	119-120	2	4

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	34-71	38

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	34-74	41

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tax1-binding protein 1	A, B	protein	121	Homo sapiens	Q86VP1 (AlphaFold model)
5-azacytidine-induced protein 2	C, D	protein	43	Homo sapiens	Q9H6S1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5Z7G_1 Tax1-binding protein 1 (chains A, B)
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTA
RDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQF
R

Sequence of entity 2 (C, D), FASTA

>5Z7G_2 5-azacytidine-induced protein 2 (chains C, D)
ESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLEEKLIA

Primary citation

Mechanistic insights into the interactions of NAP1 with the SKICH domains of NDP52 and TAX1BP1. Fu, T., Liu, J., Wang, Y. et al. Proc Natl Acad Sci U S A (2018) 115:E11651-E11660. DOI 10.1073/pnas.1811421115 · PubMed

Other PDB entries of the same protein (UniProt Q86VP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YT6 1.5 Å, Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin
8W6A 1.53 Å, Crystal structure of TAX1BP1 LIR region in complex with GABARAP
4NLH 1.9 Å, SKICH domain of human TAX1BP1
4Z4M 2.15 Å, Crystal structure of GFP-TAX1BP1 UBZ2 domain fusion protein
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain
4BMJ 2.75 Å, Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1
4Z4K 2.8 Å, Crystal structure of GFP-TAX1BP1 UBZ1+2 domain fusion protein
2M7Q Solution structure of TAX1BP1 UBZ1+2
5AAS The selective autophagy receptor TAX1BP1 is required for autophagy- dependent capture of…

Browse structure collections

About this viewer

MolViewer shows 5Z7G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.