6AKP: Crystal Structural of FOXC2 DNA binding domain

Crystal Structural of FOXC2 DNA binding domain bound to PC promoter. Determined by X-ray diffraction at 2.32 Å resolution. Released 6 Feb 2019.

Method: X-ray diffraction
Resolution: 2.32 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,464
Mol. weight: 22.15 kDa
Ligands: MG
Released: 6 Feb 2019

Explore 6AKP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AKP contains 6 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	71-73	3
α-helix	77-87	11
β-strand	93	1	1
α-helix	95-105	11
α-helix	107-110	4
α-helix	113-126	14
β-strand	130-133	4	1
β-strand	145-148	4	1
α-helix	150-152	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(apcpapcpapapaptpaptptptpgptpgp*t)-3')	A, B	DNA	16	Homo sapiens
Forkhead box protein C2	C	protein	103	Homo sapiens	Q99958 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6AKP_1 DNA (5'-D(AP*CP*AP*CP*AP*AP*AP*TP*AP*TP*TP*TP*GP*TP*GP*T)-3') (chains A, B)
ACACAAATATTTGTGT

Sequence of entity 2 (C), FASTA

>6AKP_2 Forkhead box protein C2 (chains C)
GPKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNEC
FVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structural basis for DNA recognition by FOXC2. Chen, X., Wei, H., Li, J. et al. Nucleic Acids Res (2019) 47:3752-3764. DOI 10.1093/nar/gkz077 · PubMed

Other PDB entries of the same protein (UniProt Q99958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AKO 2.4 Å, Crystal Structure of FOXC2 DBD Bound to DBE2 DNA
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
6LBM 2.84 Å, Crystal Structure of FOXC2-DBD bound to a palindromic DNA sequence
6O3T 3.06 Å, Structural basis of FOXC2 and DNA interactions
1D5V Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11…

Browse structure collections

About this viewer

MolViewer shows 6AKP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.