6AO4: Human gasdermin D C-terminal domain

Crystal structure of the human gasdermin D C-terminal domain. Determined by X-ray diffraction at 2.9 Å resolution. Released 11 Apr 2018.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,445
Mol. weight: 22.35 kDa
Released: 11 Apr 2018

Explore 6AO4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AO4 contains 14 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	288-300	13
α-helix	307-321	15
α-helix	323-330	8
α-helix	347-356	10
β-strand	357	1	1
α-helix	362	1
β-strand	363	1	1
α-helix	364	1
α-helix	365-380	16
α-helix	383-393	11
α-helix	399-411	13
β-strand	419	1	2
β-strand	422	1	3
α-helix	423-424	2
α-helix	426-428	3
α-helix	437-443	7
β-strand	448	1	4
β-strand	455	1	3
β-strand	457	1	4
β-strand	458	1	2
α-helix	460-462	3
α-helix	463-480	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gasdermin-D	A	protein	209	Homo sapiens	P57764 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6AO4_1 Gasdermin-D (chains A)
SVPAEGAFTEDFQGLRAEVETISKELELLDRELCQLLLEGLEGVLRDQLALRALEEALEQ
GQSLGPVEPLDGPAGAVLECLVLSSGMLVPELAIPVVYLLGALTMLSETQHKLLAEALES
QTLLGPLELVGSLLEQSAPWQERSTMSLPPGLLGNSWGEGAPAWVLLDECGLELGEDTPH
VCWEPQAQGRMCALYASLALLSGLSQEPH

Primary citation

Structures of the Gasdermin D C-Terminal Domains Reveal Mechanisms of Autoinhibition. Liu, Z., Wang, C., Rathkey, J.K. et al. Structure (2018) 26:778-784.e3. DOI 10.1016/j.str.2018.03.002 · PubMed

Other PDB entries of the same protein (UniProt P57764 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E0V 1.64 Å, GSDMD bound to a peptide
7Z1X 1.86 Å, Crystal structure of human Gasdermin D complexed with nanobodies VHH-2 and VHH-6
5NH1 2.04 Å, Structure of the C-terminal domain of human Gasdermin D
5WQT 2.64 Å, Structure of a protein involved in pyroptosis
6KN0 2.79 Å, caspase-1 P20/P10 C285A in complex with human GSDMD-C domain
23BD 3.4 Å, Caspase-4 p22/p10 and human GSDMD complex
6N9O 3.5 Å, Crystal structure of human GSDMD
23BB 3.6 Å, Caspase-4 p20/p10 and human GSDMD
6KMZ 3.61 Å, caspase-4 P22/P10 C258A in complex with human GSDMD-C domain
6VFE 3.9 Å, Gasdermin D pore

Browse structure collections

About this viewer

MolViewer shows 6AO4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.