9E0V: GSDMD

GSDMD bound to a peptide. Determined by X-ray diffraction at 1.64 Å resolution. Released 22 Oct 2025.

Method: X-ray diffraction
Resolution: 1.64 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,759
Mol. weight: 65.42 kDa
Released: 22 Oct 2025

Explore 9E0V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E0V contains 14 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	287-298	12
α-helix	301-302	2
β-strand	303-304	2	1
α-helix	306-320	15
α-helix	323-333	11
α-helix	334-336	3
α-helix	341-344	4
α-helix	347-354	8
β-strand	357	1	2
β-strand	363	1	2
α-helix	365-378	14
α-helix	383-394	12
α-helix	399-411	13
β-strand	419-421	3	3
α-helix	425-428	4
α-helix	437-443	7
β-strand	448-449	2	3
β-strand	456-458	3	3
α-helix	460-462	3
α-helix	463-479	17

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	7-8	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin-binding periplasmic protein, Gasdermin-D, C-terminal chimera	A	protein	590	Homo sapiens	P57764 (AlphaFold model)
Gly-cys-ile-lys-lys-ala-val-6CW-phe-lys-cys	B	protein	11	Homo sapiens

Sequence of entity 1 (A), FASTA

>9E0V_1 Maltose/maltodextrin-binding periplasmic protein, Gasdermin-D, C-terminal chimera (chains A)
MAHHHHHHKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA
TGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEA
LSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYA
AGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAW
SNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEA
VNKDKPLGAVALKSYEEELVKDPRVAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAAS
GRQTVDAALAAAQTENLYFQGGVPAEGAFTEDFQGLRAEVETISKELELLDRELCQLLLE
GLEGVLRDQLALRALEEALEQGQSLGPVEPLDGPAGAVLECLVLSSGMLVPELAIPVVYL
LGALTMLSETQHKLLAEALESQTLLGPLELVGSLLEQSAPWQERSTMSLPPGLLGNSWGE
GAPAWVLLDECGLELGEDTPHVCWEPQAQGRMCALYASLALLSGLSQEPH

Sequence of entity 2 (B), FASTA

>9E0V_2 GLY-CYS-ILE-LYS-LYS-ALA-VAL-6CW-PHE-LYS-CYS (chains B)
GCIKKAVWFKC

Primary citation

Peptide binding at the gasdermin D exosite reveals the structural basis for targeting the site. Wang, R., Ho, T., Ogawa, A. et al. Acta Crystallogr D Struct Biol (2026) 82:615-625. DOI 10.1107/S205979832600344X · PubMed

Other PDB entries of the same protein (UniProt P57764 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z1X 1.86 Å, Crystal structure of human Gasdermin D complexed with nanobodies VHH-2 and VHH-6
5NH1 2.04 Å, Structure of the C-terminal domain of human Gasdermin D
5WQT 2.64 Å, Structure of a protein involved in pyroptosis
6KN0 2.79 Å, caspase-1 P20/P10 C285A in complex with human GSDMD-C domain
6AO4 2.9 Å, Crystal structure of the human gasdermin D C-terminal domain
23BD 3.4 Å, Caspase-4 p22/p10 and human GSDMD complex
6N9O 3.5 Å, Crystal structure of human GSDMD
23BB 3.6 Å, Caspase-4 p20/p10 and human GSDMD
6KMZ 3.61 Å, caspase-4 P22/P10 C258A in complex with human GSDMD-C domain
6VFE 3.9 Å, Gasdermin D pore

Browse structure collections

About this viewer

MolViewer shows 9E0V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.