6KN0: Caspase-1 P20/P10 C285A
caspase-1 P20/P10 C285A in complex with human GSDMD-C domain. Determined by X-ray diffraction at 2.79 Å resolution. Released 11 Mar 2020.
- Method
- X-ray diffraction
- Resolution
- 2.79 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 6,974
- Mol. weight
- 100.58 kDa
- Released
- 11 Mar 2020
Explore 6KN0 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6KN0 contains 45 α-helices and 50 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 9 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 135-137 | 3 | |
| α-helix | 138-147 | 10 | |
| α-helix | 149-151 | 3 | |
| β-strand | 152 | 1 | 1 |
| α-helix | 153-157 | 5 | |
| β-strand | 164-169 | 6 | 2 |
| α-helix | 182-195 | 14 | |
| β-strand | 199-204 | 6 | 2 |
| α-helix | 208-219 | 12 | |
| α-helix | 222-224 | 3 | |
| β-strand | 230-235 | 6 | 2 |
| β-strand | 238 | 1 | 3 |
| β-strand | 242-244 | 3 | 3 |
| β-strand | 255-257 | 3 | 3 |
| α-helix | 258-262 | 5 | |
| α-helix | 271-273 | 3 | |
| β-strand | 278-283 | 6 | 2 |
| β-strand | 287-289 | 3 | 4 |
| β-strand | 292-296 | 5 | 5 |
Chain B: 2 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 318-322 | 5 | 6 |
| β-strand | 327-331 | 5 | 2 |
| β-strand | 336-337 | 2 | 4 |
| β-strand | 341-342 | 2 | 7 |
| β-strand | 346-347 | 2 | 7 |
| α-helix | 348-360 | 13 | |
| α-helix | 366-376 | 11 | |
| β-strand | 388-390 | 3 | 2 |
| β-strand | 392 | 1 | 8 |
| β-strand | 397 | 1 | 1 |
Chain C: 7 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 134-136 | 3 | |
| α-helix | 138-145 | 8 | |
| β-strand | 152 | 1 | 9 |
| β-strand | 163-169 | 7 | 8 |
| α-helix | 177-178 | 2 | |
| α-helix | 182-195 | 14 | |
| β-strand | 198-204 | 7 | 8 |
| α-helix | 208-219 | 12 | |
| β-strand | 230-235 | 6 | 8 |
| β-strand | 238 | 1 | 10 |
| β-strand | 242-244 | 3 | 10 |
| β-strand | 255-257 | 3 | 10 |
| α-helix | 258-264 | 7 | |
| α-helix | 271-273 | 3 | |
| β-strand | 278-283 | 6 | 8 |
| β-strand | 287-289 | 3 | 11 |
| β-strand | 292-296 | 5 | 6 |
Chain D: 2 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 318-322 | 5 | 5 |
| β-strand | 327-331 | 5 | 8 |
| β-strand | 336-337 | 2 | 11 |
| β-strand | 341-342 | 2 | 12 |
| β-strand | 346-347 | 2 | 12 |
| α-helix | 348-359 | 12 | |
| α-helix | 366-375 | 10 | |
| β-strand | 381 | 1 | 13 |
| β-strand | 383 | 1 | 13 |
| β-strand | 388-390 | 3 | 8 |
| β-strand | 392 | 1 | 2 |
| β-strand | 397 | 1 | 9 |
Chain E: 12 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 287-299 | 13 | |
| α-helix | 300-303 | 4 | |
| β-strand | 304 | 1 | 6 |
| α-helix | 306-319 | 14 | |
| α-helix | 323-333 | 11 | |
| α-helix | 340-344 | 5 | |
| α-helix | 348-353 | 6 | |
| β-strand | 357 | 1 | 14 |
| β-strand | 363 | 1 | 14 |
| α-helix | 365-378 | 14 | |
| α-helix | 383-394 | 12 | |
| α-helix | 399-411 | 13 | |
| β-strand | 419-421 | 3 | 15 |
| α-helix | 437-443 | 7 | |
| β-strand | 448-449 | 2 | 15 |
| β-strand | 456-458 | 3 | 15 |
| α-helix | 460-462 | 3 | |
| α-helix | 463-479 | 17 | |
Chain F: 13 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 287-300 | 14 | |
| α-helix | 301-303 | 3 | |
| β-strand | 304 | 1 | 5 |
| α-helix | 306-319 | 14 | |
| α-helix | 323-332 | 10 | |
| α-helix | 342-344 | 3 | |
| α-helix | 348-353 | 6 | |
| α-helix | 354-356 | 3 | |
| β-strand | 357 | 1 | 16 |
| β-strand | 363 | 1 | 16 |
| α-helix | 365-378 | 14 | |
| α-helix | 383-395 | 13 | |
| α-helix | 399-411 | 13 | |
| β-strand | 419-420 | 2 | 17 |
| α-helix | 437-443 | 7 | |
| β-strand | 448-449 | 2 | 17 |
| β-strand | 456-458 | 3 | 17 |
| α-helix | 460-462 | 3 | |
| α-helix | 463-479 | 17 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Caspase-1 | A, C | protein | 167 | Homo sapiens | P29466 (AlphaFold model) |
| Caspase-1 | B, D | protein | 88 | Homo sapiens | P29466 (AlphaFold model) |
| Gasdermin-D | E, F | protein | 198 | Homo sapiens | P57764 (AlphaFold model) |
Sequence of entity 1 (A, C), FASTA
>6KN0_1 Caspase-1 (chains A, C)
GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMT
MLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSE
QVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQAARGDSPGVVWFKD
Sequence of entity 2 (B, D), FASTA
>6KN0_2 Caspase-1 (chains B, D)
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFS
FEQPDGRAQMPTTERVTLTRCFYLFPGH
Sequence of entity 3 (E, F), FASTA
>6KN0_3 Gasdermin-D (chains E, F)
FTEDFQGLRAEVETISKELELLDRELCQLLLEGLEGVLRDQLALRALEEALEQGQSLGPV
EPLDGPAGAVLECLVLSSGMLVPELAIPVVYLLGALTMLSETQHKLLAEALESQTLLGPL
ELVGSLLEQSAPWQERSTMSLPPGLLGNSWGEGAPAWVLLDECGLELGEDTPHVCWEPQA
QGRMCALYASLALLSGLS
Primary citation
Structural Mechanism for GSDMD Targeting by Autoprocessed Caspases in Pyroptosis. Wang, K., Sun, Q., Zhong, X. et al. Cell (2020) 180:941. DOI 10.1016/j.cell.2020.02.002 · PubMed
Other PDB entries of the same protein (UniProt P29466 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8WRA 1.45 Å, The Crystal Structure of CASP1 from Biortus
- 6BZ9 1.8 Å, Crystal structure of human caspase-1 in complex with Ac-FLTD-CMK
- 1SC3 1.8 Å, Crystal structure of the human caspase-1 C285A mutant in complex with malonate
- 2H54 1.8 Å, Crystal structure of human caspase-1 (Thr388->Ala) in complex with…
- 2HBQ 1.8 Å, Crystal structure of wildtype human caspase-1 in complex with…
- 3D6M 1.8 Å, Crystal structure of human caspase-1 with a naturally-occurring Lys319->Arg substitution…
- 6F6R 1.8 Å, Crystal structure of human Caspase-1 with N-{3-[1-((S)-2-Hydroxy-5-oxo-tetrahydro-furan-3…
- 1RWX 1.85 Å, Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-b…
- 2H4Y 1.9 Å, Crystal structure of human caspase-1 (Arg286->Lys) in complex with…
- 2HBZ 1.9 Å, Crystal structure of human caspase-1 (Arg286->Ala, Glu390->Ala) in complex with…
- 3D6F 1.9 Å, Crystal structure of human caspase-1 with a naturally-occurring Arg240->Gln substitution…
- 6PZP 1.94 Å, Crystal structure of caspase-1 in complex with VX-765
Browse structure collections
About this viewer
MolViewer shows 6KN0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.