6AO5: Human MST2

Crystal structure of human MST2 in complex with SAV1 SARAH domain. Determined by X-ray diffraction at 2.96 Å resolution. Released 8 Nov 2017.

Method: X-ray diffraction
Resolution: 2.96 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,372
Mol. weight: 53.54 kDa
Ligands: MG, ANP
Released: 8 Nov 2017

Explore 6AO5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AO5 contains 26 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	32-34	3	1
β-strand	41-44	4	1
β-strand	53-56	4	1
α-helix	64-74	11
β-strand	82	1	2
α-helix	83-84	2
β-strand	85-89	5	1
β-strand	96-100	5	1
β-strand	106	1	2
α-helix	107-114	8
α-helix	120-139	20
α-helix	149-151	3
β-strand	152-154	3	2
β-strand	160-162	3	2
α-helix	190-193	4
α-helix	202-216	15
α-helix	226-235	10
α-helix	237-239	3
α-helix	244-246	3
α-helix	249-258	10
α-helix	263-265	3
α-helix	269-272	4
α-helix	276-279	4
α-helix	281-283	3
α-helix	284-287	4
α-helix	288-307	20
α-helix	312-429	4
α-helix	431-432	2
α-helix	438-442	5
α-helix	445-487	43

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	294-297	4
α-helix	298-300	3
α-helix	303-305	3
α-helix	306-313	8
α-helix	329-375	47

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 3	A	protein	362	Homo sapiens	Q13188 (AlphaFold model)
Protein salvador homolog 1	B	protein	93	Homo sapiens	Q9H4B6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6AO5_1 Serine/threonine-protein kinase 3 (chains A)
EDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQ
QCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLE
YLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQE
IGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFV
KKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEENW
KVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQ
NF

Sequence of entity 2 (B), FASTA

>6AO5_2 Protein salvador homolog 1 (chains B)
SLLVPANPYHTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQI
VKMYEAYRQALLTELENRKQRQQWYAQQHGKNF

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

SAV1 promotes Hippo kinase activation through antagonizing the PP2A phosphatase STRIPAK. Bae, S.J., Ni, L., Osinski, A. et al. Elife (2017) 6. DOI 10.7554/eLife.30278 · PubMed

Other PDB entries of the same protein (UniProt Q13188 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L0N 1.4 Å, Crystal structure of STK3 (MST2) SARAH domain
4HKD 1.5 Å, Crystal structure of human MST2 SARAH domain
6AR2 1.55 Å, Structure of human SLMAP FHA domain in complex with pMST2
4OH9 1.7 Å, Crystal Structure of the human MST2 SARAH homodimer
8A66 1.9 Å, Crystal structure of MST2 in complex with XMU-MP-1
3WWS 2.01 Å, Crystal structure of Serine/threonine-protein kinase 3
4LG4 2.42 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5
5DH3 2.47 Å, Crystal structure of MST2 in complex with XMU-MP-1
5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…
4LGD 3.05 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5

Browse structure collections

About this viewer

MolViewer shows 6AO5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.