6AR2: Human SLMAP FHA domain

Structure of human SLMAP FHA domain in complex with pMST2. Determined by X-ray diffraction at 1.55 Å resolution. Released 4 Jul 2018.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,413
Mol. weight: 34.16 kDa
Released: 4 Jul 2018

Explore 6AR2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AR2 contains 7 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
α-helix	15-16	2
β-strand	20-23	4	1
β-strand	28-30	3	2
β-strand	31-32	2	3
β-strand	34	1	4
β-strand	37	1	4
β-strand	45-46	2	3
β-strand	56-61	6	2
β-strand	66-71	6	2
β-strand	72	1	5
β-strand	78-80	3	1
β-strand	83-84	2	1
β-strand	91	1	5
α-helix	92-94	3
β-strand	95-97	3	2
β-strand	102-105	4	1
β-strand	109-111	3	6
β-strand	116-118	3	6
α-helix	119	1
β-strand	121-128	8	1
β-strand	134	1	1

Chain B: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	7
α-helix	11	1
α-helix	15-16	2
β-strand	20-23	4	7
β-strand	28-30	3	8
β-strand	31-32	2	9
β-strand	34	1	10
β-strand	37	1	10
β-strand	45-46	2	9
β-strand	56-61	6	8
β-strand	66-71	6	8
β-strand	72	1	11
β-strand	78-80	3	7
β-strand	83-84	2	7
β-strand	91	1	11
α-helix	92-94	3
β-strand	95-97	3	8
β-strand	102-105	4	7
β-strand	109-111	3	12
β-strand	116-118	3	12
α-helix	119	1
β-strand	121-128	8	7
β-strand	134	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sarcolemmal membrane-associated protein	A, B	protein	140	Homo sapiens	Q14BN4 (AlphaFold model)
Asp-gly-tpo-met-lys-arg	C, D	protein	10	Homo sapiens	Q13188 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6AR2_1 Sarcolemmal membrane-associated protein (chains A, B)
MPSALAIFTCRPNSHPFQERHVYLDEPIKIGRSVARCRPAQNNATFDCKVLSRNHALVWF
DHKTGKFYLQDTKSSNGTFINSQRLSRGSEESPPCEILSGDIIQFGVDVTENTRKVTHGC
IVSTIKLFLPDGMEARLRSD

Sequence of entity 2 (C, D), FASTA

>6AR2_2 ASP-GLY-TPO-MET-LYS-ARG (chains C, D)
EEEDGTMKRN

Primary citation

SAV1 promotes Hippo kinase activation through antagonizing the PP2A phosphatase STRIPAK. Bae, S.J., Ni, L., Osinski, A. et al. Elife (2017) 6. DOI 10.7554/eLife.30278 · PubMed

Other PDB entries of the same protein (UniProt Q14BN4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AR0 1.08 Å, Structure of human SLMAP FHA domain
6AKM 2.3 Å, Crystal structure of SLMAP-SIKE1 complex

Browse structure collections

About this viewer

MolViewer shows 6AR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.