6B1M: Heat shock protein family A member 8

Disrupted hydrogen bond network impairs ATPase activity in an Hsc70 cysteine mutant. Determined by X-ray diffraction at 1.9 Å resolution. Released 17 Jan 2018.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo Sapiens
Chains: 2
Atoms: 6,841
Mol. weight: 89.51 kDa
Ligands: MG, ANP
Released: 17 Jan 2018

Explore 6B1M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6B1M contains 39 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	6
β-strand	15-22	8	6
β-strand	25-28	4	6
α-helix	29-30	2
β-strand	38-39	2	6
β-strand	42-44	3	7
β-strand	49-51	3	7
α-helix	53-56	4
α-helix	63-65	3
β-strand	66-67	2	7
α-helix	70-72	3
α-helix	81-87	7
β-strand	93-97	5	8
β-strand	100-107	8	8
β-strand	110-114	5	8
α-helix	116-135	20
β-strand	141-146	6	6
α-helix	152-164	13
β-strand	168-174	7	6
α-helix	175-182	8
β-strand	193-200	8	9
β-strand	205-213	9	9
β-strand	216-225	10	9
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	10
β-strand	291-298	8	10
α-helix	299-305	7
α-helix	307-312	6
α-helix	314-324	11
α-helix	328-330	3
β-strand	333-337	5	9
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	9
α-helix	365-367	3
α-helix	368-380	13

Chain B: 20 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-22	8	1
β-strand	25-28	4	1
α-helix	29-30	2
β-strand	38-39	2	1
β-strand	42-44	3	2
β-strand	49-51	3	2
α-helix	53-56	4
α-helix	63-65	3
β-strand	66-67	2	2
α-helix	70-72	3
α-helix	81-86	6
α-helix	87-89	3
β-strand	93-97	5	3
β-strand	100-107	8	3
β-strand	110-114	5	3
α-helix	116-135	20
β-strand	141-146	6	1
α-helix	152-164	13
β-strand	168-174	7	1
α-helix	175-182	8
α-helix	185-187	3
β-strand	193-200	8	4
β-strand	205-213	9	4
β-strand	216-225	10	4
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	5
β-strand	291-298	8	5
α-helix	299-305	7
α-helix	307-312	6
α-helix	314-324	11
α-helix	328-330	3
β-strand	333-337	5	4
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	4
α-helix	368-380	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein family A (Hsp70) member 8	A, B	protein	400	Homo Sapiens	P11142 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6B1M_1 Heat shock protein family A (Hsp70) member 8 (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASPAVGIDLGTTYSWVGVFQHGKVEIIANDQGNRTTPSY
VAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRP
KVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDA
GTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKS
TAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQAS
IEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGST
RIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Disrupted Hydrogen-Bond Network and Impaired ATPase Activity in an Hsc70 Cysteine Mutant. O'Donnell, J.P., Marsh, H.M., Sondermann, H. et al. Biochemistry (2018) 57:1073-1086. DOI 10.1021/acs.biochem.7b01005 · PubMed

Other PDB entries of the same protein (UniProt P11142 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AQM 1.63 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
4H5R 1.64 Å, HSC70 NBD with Na, Cl and glycerol
5AQL 1.69 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
4H5V 1.75 Å, HSC70 NBD with Mg
5AQV 1.75 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
6B1N 1.8 Å, Disrupted hydrogen bond network impairs ATPase activity in an Hsc70 cysteine mutant
3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
6ZYJ 1.85 Å, Crystal structure of Hsc70 ATPase domain in complex with ADP and calcium
4H5N 1.86 Å, HSC70 NBD with PO4, Na, Cl
5AQF 1.88 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3LDQ 1.9 Å, Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor
4H5T 1.9 Å, HSC70 NBD with ADP and Mg

Browse structure collections

About this viewer

MolViewer shows 6B1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.