6CM4: D2 Dopamine Receptor

Structure of the D2 Dopamine Receptor Bound to the Atypical Antipsychotic Drug Risperidone. Determined by X-ray diffraction at 2.87 Å resolution. Released 14 Mar 2018.

Method: X-ray diffraction
Resolution: 2.87 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,236
Mol. weight: 50.46 kDa
Ligands: 8NU, OLA
Released: 14 Mar 2018

Explore 6CM4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CM4 contains 26 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	36-61	26
α-helix	63-65	3
α-helix	68-86	19
α-helix	88-97	10
α-helix	104-137	34
α-helix	147-167	21
α-helix	168-175	8
α-helix	183-185	3
α-helix	189-194	6
α-helix	195-199	5
α-helix	200-1007	29
α-helix	1008-1012	5
β-strand	1014-1015	2	1
β-strand	1016	1	2
β-strand	1017-1019	3	1
β-strand	1025-1028	4	1
β-strand	1031-1034	4	1
α-helix	1039-1050	12
β-strand	1057	1	2
α-helix	1060-1080	21
α-helix	1085-1090	6
α-helix	1093-1111	19
α-helix	1115-1122	8
α-helix	1126-1133	8
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	369-398	30
α-helix	401-403	3
α-helix	405-417	13
α-helix	418-420	3
α-helix	422-429	8
α-helix	431-440	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
D(2) dopamine receptor, endolysin chimera	A	protein	430	Homo sapiens, Enterobacteria phage T4	P00720, P14416 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6CM4_1 D(2) dopamine receptor, endolysin chimera (chains A)
NYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYL
EVVGEWKFSRIHCDIFVTLDVMMCTASALNLCAISIDRYTAVAMPMLYNTRYSSKRRVTV
MISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYI
VLRRRRKRNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRN
TNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAG
FTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKLSQQKEKKATQ
MAAIVAGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEF
RKAFLKILHC

Ligands and cofactors

ID	Name	Formula	Copies
8NU	3-[2-[4-(6-fluoranyl-1,2-benzoxazol-3-yl)piperidin-1-yl]ethyl]-2-methyl-6,7,8,9…	C23 H27 F N4 O2	1
OLA	Oleic acid	C18 H34 O2	3

Water and common crystallization additives (PEG) are not listed.

Primary citation

Structure of the D2 dopamine receptor bound to the atypical antipsychotic drug risperidone. Wang, S., Che, T., Levit, A. et al. Nature (2018) 555:269-273. DOI 10.1038/nature25758 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse more

6CM4 is part of these collections:

About this viewer

MolViewer shows 6CM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.