2.4 Angstrom crystal structure of the F141L Ca/CaM:CaV1.2 IQ domain complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 17 Oct 2018.
Explore 6DAF in 3D Show helices and sheets RCSB PDB PDBe
6DAF contains 18 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-19 | 14 | |
| β-strand | 26-27 | 2 | 1 |
| α-helix | 29-38 | 10 | |
| α-helix | 45-55 | 11 | |
| β-strand | 63-64 | 2 | 1 |
| α-helix | 65-78 | 14 | |
| α-helix | 81-92 | 12 | |
| β-strand | 100 | 1 | 2 |
| α-helix | 102-111 | 10 | |
| α-helix | 118-128 | 11 | |
| β-strand | 136 | 1 | 2 |
| α-helix | 138-145 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1617-1633 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1616-1634 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calmodulin-1 | A, B | protein | 148 | Homo sapiens | P0DP23 (AlphaFold model) |
| Voltage-dependent L-type calcium channel subunit alpha-1C | C, D | protein | 37 | Homo sapiens | Q13936 (AlphaFold model) |
>6DAF_1 Calmodulin-1 (chains A, B) ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE VDEMIREADIDGDGQVNYEELVQMMTAK
>6DAF_2 Voltage-dependent L-type calcium channel subunit alpha-1C (chains C, D) SNADEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPS
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 8 |
Arrhythmia mutations in calmodulin cause conformational changes that affect interactions with the cardiac voltage-gated calcium channel. Wang, K., Holt, C., Lu, J. et al. Proc Natl Acad Sci U S A (2018) 115:E10556-E10565. DOI 10.1073/pnas.1808733115 · PubMed
Other PDB entries of the same protein (UniProt P0DP23 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6DAF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.