6EB6: BAX W139A monomer

Crystal structure of BAX W139A monomer. Determined by X-ray diffraction at 2.02 Å resolution. Released 10 Apr 2019.

Method: X-ray diffraction
Resolution: 2.02 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,492
Mol. weight: 21.27 kDa
Released: 10 Apr 2019

Explore 6EB6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EB6 contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	16-39	24
α-helix	54-71	18
α-helix	74-81	8
α-helix	88-99	12
α-helix	107-126	20
α-helix	131-143	13
α-helix	144-148	5
α-helix	149-154	6
α-helix	159-165	7
α-helix	170-189	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator BAX	A	protein	192	Homo sapiens	Q07812 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EB6_1 Apoptosis regulator BAX (chains A)
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGATLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG

Primary citation

BAX Activation: Mutations Near Its Proposed Non-canonical BH3 Binding Site Reveal Allosteric Changes Controlling Mitochondrial Association. Dengler, M.A., Robin, A.Y., Gibson, L. et al. Cell Rep (2019) 27:359-373.e6. DOI 10.1016/j.celrep.2019.03.040 · PubMed

Other PDB entries of the same protein (UniProt Q07812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZIE 1.8 Å, Crystal Structure of core/latch dimer of Bax in complex with BimBH3
5W60 1.8 Å, Crystal structure of BAXP168G monomer cryo-protected with ethylene glycol
4S0O 1.9 Å, Crystal Structure of the Autoinhibited Dimer of Pro-apoptotic BAX (I)
5W5Z 2.0 Å, Crystal structure of BAXP168G in complex with an activating antibody at high resolution
8SRX 2.09 Å, Crystal structure of BAK-BAX heterodimer with lysoPC
8G1T 2.09 Å, Crystal structure of Bax core domain BH3-groove dimer - tetrameric fraction P21
6TRR 2.12 Å, Structural insight into tanapoxvirus mediated inhibition of apoptosis
4ZII 2.19 Å, Crystal Structure of core/latch dimer of BaxI66A in complex with BidBH3
4ZIG 2.2 Å, Crystal Structure of core/latch dimer of Bax in complex with BidBH3mini
8SPF 2.2 Å, Crystal structure of Bax core domain BH3-groove dimer - hexameric fraction with…
4BD2 2.21 Å, Bax domain swapped dimer in complex with BidBH3
7ADT 2.21 Å, Orf virus Apoptosis inhibitor ORFV125

Browse structure collections

About this viewer

MolViewer shows 6EB6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.