6GFI: Human Mesotrypsin

Structure of Human Mesotrypsin in complex with APPI variant T11V/M17R/I18F/F34V. Determined by X-ray diffraction at 2.3 Å resolution. Released 12 Sept 2018.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,273
Mol. weight: 66.95 kDa
Released: 12 Sept 2018

Explore 6GFI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GFI contains 22 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-37	6	3
β-strand	39-48	10	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-67	4	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	95	1	5
β-strand	100	1	5
β-strand	104-108	5	3
β-strand	122	1	2
α-helix	123-124	2
α-helix	128-130	3
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-162	7	2
α-helix	167-171	5
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	204-215	8	2
β-strand	221A	1	6
β-strand	224	1	6
α-helix	225	1
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-243	9

Chain B: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	8
β-strand	20-21	2	9
α-helix	22	1
β-strand	30-37	6	10
β-strand	39-48	10	10
β-strand	51-54	4	10
α-helix	56-58	3
β-strand	64-67	4	10
β-strand	72	1	11
β-strand	81-90	10	10
β-strand	95	1	12
β-strand	100	1	12
β-strand	104-108	5	10
α-helix	111-114	4
β-strand	122	1	9
α-helix	123-124	2
α-helix	128-130	3
β-strand	135-140	6	9
β-strand	154	1	11
β-strand	156-162	7	9
α-helix	165-171	7
β-strand	180-183	4	9
β-strand	189	1	8
β-strand	198-201	4	9
β-strand	204-215	8	9
β-strand	221A	1	13
β-strand	224	1	13
α-helix	225	1
β-strand	226-230	5	9
α-helix	231-234	4
α-helix	235-243	9

Chain C: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	8-9	2
β-strand	14	1	9
β-strand	18-24	7	14
β-strand	29-35	7	14
β-strand	45	1	14
α-helix	48-55	8

Chain E: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-9	2
β-strand	14	1	2
β-strand	18-24	7	7
β-strand	29-35	7	7
β-strand	45	1	7
α-helix	48-55	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PRSS3 protein	A, B	protein	224	Homo sapiens	P35030 (AlphaFold model)
Amyloid-beta A4 protein	C, E	protein	81	Homo sapiens	P05067 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6GFI_1 PRSS3 protein (chains A, B)
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEG
NEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISG
WGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGP
VVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS

Sequence of entity 2 (C, E), FASTA

>6GFI_2 Amyloid-beta A4 protein (chains C, E)
YVDYKDDDDKEVEVCSEQAEVGPCRARFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEY
CMAVCGSAIPRHHHHHHAAAN

Primary citation

Mapping protein selectivity landscapes using multi-target selective screening and next-generation sequencing of combinatorial libraries. Naftaly, S., Cohen, I., Shahar, A. et al. Nat Commun (2018) 9:3935-3935. DOI 10.1038/s41467-018-06403-x · PubMed

Other PDB entries of the same protein (UniProt P35030 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TP0 1.25 Å, Human mesotrypsin in complex with diminazene
3P95 1.3 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant…
2R9P 1.4 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor(BPTI)
4DG4 1.4 Å, Human mesotrypsin-S39Y complexed with bovine pancreatic trypsin inhibitor (BPTI)
5JBT 1.4 Å, Mesotrypsin in complex with cleaved amyloid precursor like protein 2 inhibitor (APLP2)
3P92 1.6 Å, Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant…
9BOT 1.6 Å, Human mesotrypsin (PRSS3) unliganded and in autoinhibited (E*) conformation
4U32 1.65 Å, Human mesotrypsin complexed with HAI-2 Kunitz domain 1
1H4W 1.7 Å, Structure of human trypsin IV (brain trypsin)
9BOS 1.7 Å, Human mesotrypsin (PRSS3) unliganded and in an active (E) conformation
5C67 1.83 Å, Human Mesotrypsin in complex with amyloid precursor protein inhibitor variant…
6BX8 1.98 Å, Human Mesotrypsin (PRSS3) Complexed with Tissue Factor Pathway Inhibitor Variant…

Browse structure collections

About this viewer

MolViewer shows 6GFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.