Plasmodium falciparum Myosin A, Pre-powerstroke. Determined by X-ray diffraction at 3.49 Å resolution. Released 7 Aug 2019.
Explore 6I7E in 3D Show helices and sheets RCSB PDB PDBe
6I7E contains 37 α-helices and 35 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-14 | 10 | |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 42-45 | 4 | |
| β-strand | 53-57 | 5 | 1 |
| β-strand | 62 | 1 | 2 |
| β-strand | 65 | 1 | 2 |
| β-strand | 66-72 | 7 | 1 |
| β-strand | 79-82 | 4 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 87-89 | 3 | 1 |
| β-strand | 101 | 1 | 3 |
| α-helix | 102-104 | 3 | |
| α-helix | 110-121 | 12 | |
| β-strand | 127-129 | 3 | 3 |
| β-strand | 134-137 | 4 | 3 |
| α-helix | 148-155 | 8 | |
| α-helix | 164 | 1 | |
| α-helix | 167-180 | 14 | |
| β-strand | 185-190 | 6 | 3 |
| β-strand | 192 | 1 | 4 |
| α-helix | 197-208 | 12 | |
| α-helix | 218-225 | 8 | |
| α-helix | 227-235 | 9 | |
| β-strand | 236-237 | 2 | 5 |
| β-strand | 245-246 | 2 | 5 |
| β-strand | 249-257 | 9 | 3 |
| β-strand | 261-270 | 10 | 3 |
| α-helix | 275-278 | 4 | |
| β-strand | 287 | 1 | 5 |
| α-helix | 288-296 | 9 | |
| α-helix | 299-301 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 328-340 | 13 | |
| α-helix | 346-362 | 17 | |
| α-helix | 365-366 | 2 | |
| β-strand | 367-370 | 4 | 6 |
| α-helix | 372-375 | 4 | |
| β-strand | 378-381 | 4 | 6 |
| α-helix | 386-396 | 11 | |
| α-helix | 400-406 | 7 | |
| β-strand | 409 | 1 | 7 |
| β-strand | 412-414 | 3 | 8 |
| β-strand | 417-419 | 3 | 8 |
| β-strand | 422 | 1 | 7 |
| β-strand | 424 | 1 | 6 |
| α-helix | 425-455 | 31 | |
| β-strand | 465-469 | 5 | 3 |
| β-strand | 473 | 1 | 4 |
| α-helix | 481-498 | 18 | |
| α-helix | 499-503 | 5 | |
| α-helix | 504-511 | 8 | |
| α-helix | 524-532 | 9 | |
| α-helix | 540-547 | 8 | |
| α-helix | 553-563 | 11 | |
| β-strand | 570-572 | 3 | 9 |
| β-strand | 581-584 | 4 | 9 |
| β-strand | 589-592 | 4 | 9 |
| α-helix | 597-601 | 5 | |
| α-helix | 608-614 | 7 | |
| α-helix | 619-623 | 5 | |
| α-helix | 641-658 | 18 | |
| β-strand | 660-667 | 8 | 3 |
| α-helix | 680-689 | 10 | |
| α-helix | 697-700 | 4 | |
| β-strand | 703 | 1 | 10 |
| β-strand | 707-708 | 2 | 11 |
| α-helix | 709-715 | 7 | |
| α-helix | 731-742 | 12 | |
| β-strand | 749-751 | 3 | 11 |
| β-strand | 755-758 | 4 | 11 |
| β-strand | 759 | 1 | 10 |
| α-helix | 762-765 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin-A | A | protein | 768 | Plasmodium falciparum 3D7 | Q8IDR3 (AlphaFold model) |
>6I7E_1 Myosin-A (chains A) MAVTNEEIKTASKIVRRVSNVEAFDKSGSVFKGYQIWTDISPTIENDPNIMFVKCVVQQG SKKEKLTVVQIDPPGTGTPYDIDPTHAWNCNSQVDPMSFGDIGLLNHTNIPCVLDFLKHR YLKNQIYTTAVPLIVAINPYKDLGNTTNEWIRRYRDTADHTKLPPHVFTCAREALSNLHG VNKSQTIIVSGESGAGKTEATKQIMRYFASSKSGNMDLRIQTAIMAANPVLEAFGNAKTI RNNNSSRFGRFMQLVISHEGGIRYGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGANST MKSKFGLKGVTEYKLLNPNSTEVSGVDDVKDFEEVIESLKNMELSESDIEVIFSIVAGIL TLGNVRLIEKQEAGLSDAAAIMDEDMGVFNKACELMYLDPELIKREILIKVTVAGGTKIE GRWNKNDAEVLKSSLCKAMYEKLFLWIIRHLNSRIEPEGGFKTFMGMLDIFGFEVFKNNS LEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTAELKYTSNKEVINVLCEKGKSVLS YLEDQCLAPGGTDEKFVSSCATNLKENNKFTPAKVASNKNFIIQHTIGPIQYCAESFLLK NKDVLRGDLVEVIKDSPNPIVQQLFEGQVIEKGKIAKGSLIGSQFLNQLTSLMNLINSTE PHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFEEFLYQYKFVD IAAAEDSSVENQNKCVNILKLSGLSESMYKIGKSMVFLKQEGAKILTK
| ID | Name | Formula | Copies |
|---|---|---|---|
| VO4 | Vanadate ion | O4 V | 1 |
| MG | Magnesium ion | Mg | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Plasmodium myosin A drives parasite invasion by an atypical force generating mechanism. Robert-Paganin, J., Robblee, J.P., Auguin, D. et al. Nat Commun (2019) 10:3286-3286. DOI 10.1038/s41467-019-11120-0 · PubMed
Other PDB entries of the same protein (UniProt Q8IDR3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.