6IGK: Human ETB receptor

Crystal Structure of human ETB receptor in complex with Endothelin-3. Determined by X-ray diffraction at 2.0 Å resolution. Released 21 Nov 2018.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Enterobacteria phage RB59
Chains: 2
Atoms: 4,385
Mol. weight: 63.08 kDa
Ligands: OLC, CIT
Released: 21 Nov 2018

Explore 6IGK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IGK contains 24 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	87-90	4
α-helix	98-128	31
α-helix	130-132	3
α-helix	135-164	30
α-helix	170-204	35
α-helix	209-210	2
α-helix	216-232	17
α-helix	234-239	6
β-strand	240-247	8	1
β-strand	250-257	8	1
α-helix	264-278	15
α-helix	279-283	5
α-helix	284-1009	30
β-strand	1012-1013	2	2
β-strand	1014	1	3
β-strand	1015-1017	3	2
β-strand	1023-1026	4	2
β-strand	1029-1032	4	2
α-helix	1037-1048	12
β-strand	1055	1	3
α-helix	1058-1077	20
α-helix	1083-1088	6
α-helix	1091-1110	20
α-helix	1113-1120	8
α-helix	1124-1131	8
α-helix	1135-1139	5
α-helix	1141-1153	13
α-helix	1157-1159	3
α-helix	313-349	37
α-helix	358-389	32
α-helix	391-401	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin receptor type B,Endolysin,Endothelin receptor type B	A	protein	498	Homo sapiens, Enterobacteria phage RB59	P24530 (AlphaFold model)
Endothelin-3	B	protein	21	Homo sapiens	P14138 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IGK_1 Endothelin receptor type B,Endolysin,Endothelin receptor type B (chains A)
GGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTL
LYIIYKNKCMRNGPNILIASLALGDLLHIVIAIPINVYKLLAEDWPFGAEMCKLVPFIQK
ASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDI
ITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLR
KNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITK
DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM
LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNDHLKQRREVAKTVFCLV
LVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCANPIALYLV
SKRFKNAFKSALCCWAQS

Sequence of entity 2 (B), FASTA

>6IGK_2 Endothelin-3 (chains B)
CTCFTYKDKECVYYCHLDIIW

Ligands and cofactors

ID	Name	Formula	Copies
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	12
CIT	Citric acid	C6 H8 O7	1

Primary citation

Crystal structures of human ETBreceptor provide mechanistic insight into receptor activation and partial activation. Shihoya, W., Izume, T., Inoue, A. et al. Nat Commun (2018) 9:4711-4711. DOI 10.1038/s41467-018-07094-0 · PubMed

Other PDB entries of the same protein (UniProt P24530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5X93 2.2 Å, Human endothelin receptor type-B in complex with antagonist K-8794
5GLI 2.5 Å, Human endothelin receptor type-B in the ligand-free form
6IGL 2.7 Å, Crystal Structure of human ETB receptor in complex with IRL1620
6K1Q 2.7 Å, Human endothelin receptor type-B in complex with inverse agonist IRL2500
5GLH 2.8 Å, Human endothelin receptor type-B in complex with ET-1
8IY5 2.8 Å, ETB-Gi complex bound to endothelin-1
8HBD 2.99 Å, Cryo-EM structure of IRL1620-bound ETBR-Gi complex
6LRY 3.0 Å, Crystal structure of human endothelin ETB receptor in complex with sarafotoxin S6b
8XVE 3.0 Å, Cryo-EM structure of ETBR bound with BQ3020
8IY6 3.13 Å, ETB-Gi complex bound to Endotheline-1, focused on receptor
8XGR 3.2 Å, ETB-eGt complex bound to endothelin-1
8XWP 3.21 Å, Cryo-EM structure of ET-1 bound ETBR-DNGI complex

Browse structure collections

About this viewer

MolViewer shows 6IGK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.