6K1Q: Human endothelin receptor type-B

Human endothelin receptor type-B in complex with inverse agonist IRL2500. Determined by X-ray diffraction at 2.7 Å resolution. Released 17 Jul 2019.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,541
Mol. weight: 55.93 kDa
Ligands: OLC, PO4, D2U
Released: 17 Jul 2019

Explore 6K1Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6K1Q contains 18 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	92-128	37
α-helix	130-132	3
α-helix	135-163	29
α-helix	170-203	34
α-helix	215-239	25
β-strand	240-247	8	1
β-strand	250-257	8	1
α-helix	264-278	15
α-helix	279-283	5
α-helix	284-1011	30
α-helix	1017-1030	14
α-helix	1035-1040	6
α-helix	1043-1062	20
α-helix	1065-1072	8
α-helix	1076-1084	9
α-helix	1087-1091	5
α-helix	1093-1105	13
α-helix	313-349	37
α-helix	354-389	36
α-helix	391-400	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin B receptor,Endolysin,Endothelin B receptor	A	protein	464	Homo sapiens, Enterobacteria phage T4	P00720, P24530 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6K1Q_1 Endothelin B receptor,Endolysin,Endothelin B receptor (chains A)
GGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTL
LYIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQK
ASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDI
ITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLR
KNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMV
FQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLN
DHLKQRREVAKTVFCLVLVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGI
NMASLNSCANPIALYLVSKRFKNAFKSALCCWAQSPSSENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	8
PO4	Phosphate ion	O4 P	4
D2U	(2~{S})-2-[[(2~{R})-2-[(3,5-dimethylphenyl)carbonyl-methyl-amino]-3-(4-phenylph…	C36 H35 N3 O4	1

Primary citation

Crystal structure of human endothelin ETBreceptor in complex with peptide inverse agonist IRL2500. Nagiri, C., Shihoya, W., Inoue, A. et al. Commun Biol (2019) 2:236-236. DOI 10.1038/s42003-019-0482-7 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 6K1Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.