6IGL: Human ETB receptor

Crystal Structure of human ETB receptor in complex with IRL1620. Determined by X-ray diffraction at 2.7 Å resolution. Released 21 Nov 2018.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Enterobacteria phage RB59
Chains: 2
Atoms: 4,038
Mol. weight: 59.42 kDa
Ligands: OLC, CIT
Released: 21 Nov 2018

Explore 6IGL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IGL contains 24 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	98-128	31
α-helix	135-163	29
α-helix	170-201	32
α-helix	206-209	4
α-helix	218-232	15
α-helix	234-239	6
β-strand	240-247	8	1
β-strand	250-257	8	1
α-helix	264-269	6
α-helix	273-278	6
α-helix	279-283	5
α-helix	284-1008	29
β-strand	1012-1013	2	2
β-strand	1014	1	3
β-strand	1015-1017	3	2
β-strand	1023-1026	4	2
β-strand	1029-1032	4	2
α-helix	1037-1048	12
β-strand	1055	1	3
α-helix	1058-1077	20
α-helix	1083-1088	6
α-helix	1091-1110	20
α-helix	1113-1120	8
α-helix	1124-1131	8
α-helix	1135-1139	5
α-helix	1141-1153	13
α-helix	1157-1159	3
α-helix	313-335	23
α-helix	337-349	13
α-helix	358-389	32
α-helix	391-400	10

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin receptor type B,Endolysin,Endothelin receptor type B	A	protein	498	Homo sapiens, Enterobacteria phage RB59	P24530 (AlphaFold model)
IRL1620	B	protein	15	Homo sapiens

Sequence of entity 1 (A), FASTA

>6IGL_1 Endothelin receptor type B,Endolysin,Endothelin receptor type B (chains A)
GGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTL
LYIIYKNKCMRNGPNILIASLALGDLLHIVIAIPINVYKLLAEDWPFGAEMCKLVPFIQK
ASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDI
ITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLR
KNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITK
DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM
LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNDHLKQRREVAKTVFCLV
LVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCANPIALYLV
SKRFKNAFKSALCCWAQS

Sequence of entity 2 (B), FASTA

>6IGL_2 IRL1620 (chains B)
XDEEAVYFAHLDIIW

Ligands and cofactors

ID	Name	Formula	Copies
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	3
CIT	Citric acid	C6 H8 O7	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structures of human ETBreceptor provide mechanistic insight into receptor activation and partial activation. Shihoya, W., Izume, T., Inoue, A. et al. Nat Commun (2018) 9:4711-4711. DOI 10.1038/s41467-018-07094-0 · PubMed

Other PDB entries of the same protein (UniProt P24530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IGK 2.0 Å, Crystal Structure of human ETB receptor in complex with Endothelin-3
5X93 2.2 Å, Human endothelin receptor type-B in complex with antagonist K-8794
5GLI 2.5 Å, Human endothelin receptor type-B in the ligand-free form
6K1Q 2.7 Å, Human endothelin receptor type-B in complex with inverse agonist IRL2500
5GLH 2.8 Å, Human endothelin receptor type-B in complex with ET-1
8IY5 2.8 Å, ETB-Gi complex bound to endothelin-1
8HBD 2.99 Å, Cryo-EM structure of IRL1620-bound ETBR-Gi complex
6LRY 3.0 Å, Crystal structure of human endothelin ETB receptor in complex with sarafotoxin S6b
8XVE 3.0 Å, Cryo-EM structure of ETBR bound with BQ3020
8IY6 3.13 Å, ETB-Gi complex bound to Endotheline-1, focused on receptor
8XGR 3.2 Å, ETB-eGt complex bound to endothelin-1
8XWP 3.21 Å, Cryo-EM structure of ET-1 bound ETBR-DNGI complex

Browse structure collections

About this viewer

MolViewer shows 6IGL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.