6J56: Myosin VI CBD

Crystal structure of Myosin VI CBD in complex with Tom1 MBM. Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Aug 2019.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,530
Mol. weight: 36.68 kDa
Released: 21 Aug 2019

Explore 6J56 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J56 contains 22 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	1159-1163	5
β-strand	1168-1174	7	1
α-helix	1175-1176	2
α-helix	1189-1191	3
β-strand	1192-1198	7	1
β-strand	1201-1208	8	1
β-strand	1215-1218	4	1
β-strand	1220	1	2
α-helix	1223-1225	3
α-helix	1231-1234	4
α-helix	1236-1238	3
β-strand	1243-1244	2	1
α-helix	1246-1255	10
α-helix	1258-1267	10
β-strand	1271	1	2
α-helix	1272-1273	2
α-helix	1275-1280	6

Chain B: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1168-1174	7	3
β-strand	1192-1198	7	3
β-strand	1201-1208	8	3
β-strand	1215-1218	4	3
β-strand	1220	1	4
α-helix	1223-1225	3
α-helix	1231-1234	4
α-helix	1236-1238	3
β-strand	1243-1244	2	3
α-helix	1246-1255	10
α-helix	1258-1267	10
β-strand	1271	1	4
α-helix	1272-1273	2
α-helix	1275-1279	5

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	439-453	15
α-helix	459-460	2

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	438-452	15
α-helix	453-455	3
α-helix	459-460	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-VI	A, B	protein	129	Homo sapiens	Q9UM54 (AlphaFold model)
Peptide from Target of Myb protein 1	C, D	protein	27	Homo sapiens	O60784 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6J56_1 Unconventional myosin-VI (chains A, B)
ARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPIL
LVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYA
TAMLQSLLK

Sequence of entity 2 (C, D), FASTA

>6J56_2 Peptide from Target of Myb protein 1 (chains C, D)
GVTSEGKFDKFLEERAKAADRLPNLSS

Primary citation

Structure of Myosin VI/Tom1 complex reveals a cargo recognition mode of Myosin VI for tethering. Hu, S., Guo, Y., Wang, Y. et al. Nat Commun (2019) 10:3459-3459. DOI 10.1038/s41467-019-11481-6 · PubMed

Other PDB entries of the same protein (UniProt Q9UM54 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8W41 3.54 Å, Cryo-EM structure of Myosin VI in the autoinhibited state
2N0Z Solution structure of MyUb (1080-1122) of human Myosin VI
2N10 Solution structure of MyUb (1080-1131) of human Myosin VI
2N11 Solution structure of human Myosin VI isoform3 (998-1071)
2N12 Solution structure of human Myosin VI isoform3 (1050-1131)
2N13 Complex structure of MyUb (1080-1122) of human Myosin VI with K63-diUb
6E5N Solution structure of human Myosin VI isoform 3 (1050-1131) in complex with Clathrin…

Browse structure collections

About this viewer

MolViewer shows 6J56 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.