6JX6: Tetrameric form of Smac

Tetrameric form of Smac. Determined by X-ray diffraction at 2.81 Å resolution. Released 4 Dec 2019.

Method: X-ray diffraction
Resolution: 2.81 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,637
Mol. weight: 83.15 kDa
Released: 4 Dec 2019

Explore 6JX6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JX6 contains 13 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	75-120	46
α-helix	126-173	48
α-helix	177-223	47

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	70-120	51
α-helix	127-174	48
α-helix	178-215	38

Chain C: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	75-120	46
β-strand	121	1	1
β-strand	124	1	1
α-helix	126-172	47
α-helix	173-175	3
α-helix	177-221	45

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	74-120	47
α-helix	126-173	48
α-helix	178-215	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Diablo homolog, mitochondrial	A, B, C, D	protein	184	Homo sapiens	Q9NR28 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6JX6_1 Diablo homolog, mitochondrial (chains A, B, C, D)
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYR
QYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTG
ADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAY
LRED

Primary citation

Structural insights into a HECT-type E3 ligase AREL1 and its ubiquitination activitiesin vitro. Singh, S., Ng, J., Nayak, D. et al. J Biol Chem (2019) 294:19934-19949. DOI 10.1074/jbc.RA119.010327 · PubMed

Other PDB entries of the same protein (UniProt Q9NR28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TW6 1.71 Å, Structure of an ML-IAP/XIAP chimera bound to a 9mer peptide derived from Smac
4TX5 1.8 Å, Crystal structure of Smac-DIABLO (in space group P65)
1G73 2.0 Å, Crystal structure of smac bound to xiap-BIR3 domain
1FEW 2.2 Å, Crystal structure of smac/diablo
1XB0 2.2 Å, Structure of the BIR domain of IAP-like protein 2
1OXQ 2.3 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
3D9U 2.3 Å, The BIR3 domain of cIAP1 in complex with the N terminal peptide from SMAC/DIABLO (AVPIAQ).
3UIH 2.4 Å, crystal structure of human Survivin in complex with Smac/DIABLO(1-15) peptide
1XB1 2.7 Å, The Structure of the BIR domain of IAP-like protein 2
3UIJ 2.71 Å, Crystal structure of human Survivin K62Y/H80W mutant in complex with Smac/DIABLO(1-15)…
8ATO 3.0 Å, Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC
8E2I 3.04 Å, Cryo-EM structure of BIRC6/Smac

Browse structure collections

About this viewer

MolViewer shows 6JX6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.