6JYU: Human G6PD Canton

Crystal structure of Human G6PD Canton. Determined by X-ray diffraction at 1.89 Å resolution. Released 29 Apr 2020.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,605
Mol. weight: 56.63 kDa
Ligands: NAP
Released: 29 Apr 2020

Explore 6JYU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JYU contains 34 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	1
α-helix	42-43	2
α-helix	44-48	5
α-helix	49-57	9
β-strand	65-71	7	1
α-helix	77-84	8
α-helix	85-87	3
α-helix	92-94	3
α-helix	95-103	9
β-strand	105-109	5	1
α-helix	115-126	12
β-strand	135-140	6	1
α-helix	144-146	3
α-helix	147-157	11
β-strand	165-169	5	1
α-helix	177-188	12
α-helix	193-195	3
β-strand	196-198	3	1
α-helix	201-204	4
α-helix	206-216	11
α-helix	219-221	3
β-strand	230-238	9	2
α-helix	247-250	4
α-helix	254-255	2
α-helix	256-264	9
α-helix	265-272	8
α-helix	273-276	4
α-helix	281-292	12
β-strand	295	1	3
α-helix	296-298	3
α-helix	300-302	3
β-strand	303-309	7	2
α-helix	316-319	4
α-helix	322-324	3
α-helix	329	1
β-strand	337-343	7	2
β-strand	344	1	3
β-strand	353-359	7	2
β-strand	362	1	4
β-strand	366-373	8	2
α-helix	374-376	3
β-strand	389-395	7	2
β-strand	399-407	9	2
α-helix	408	1
β-strand	415-423	9	2
α-helix	424-427	4
α-helix	431-435	5
α-helix	436-446	11
α-helix	455-475	21
α-helix	477-479	3
β-strand	480-483	4	2
β-strand	486	1	4
α-helix	490-499	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose-6-phosphate 1-dehydrogenase	A	protein	485	Homo sapiens	P11413 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6JYU_1 Glucose-6-phosphate 1-dehydrogenase (chains A)
SDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFF
KATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTVYE
AVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIDHYLGKEMV
QNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQML
CLVAMEKPASTNSDDVRDEKVKVLKCISEVQANNVVLGQYVGNPDGEGEATKGYLDDPTV
PRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQCKRN
ELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGS
QMHFVRSDELLEAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYK
WVNPH

Ligands and cofactors

ID	Name	Formula	Copies
NAP	NADP nicotinamide-adenine-dinucleotide phosphate	C21 H28 N7 O17 P3	1

Primary citation

Crystal structure of Human G6PD Canton. Au, S.W.N. To be published.

Other PDB entries of the same protein (UniProt P11413 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6E08 1.9 Å, Crystal structure of G6PD in complex with structural NADP
7SNH 2.2 Å, Structure of G6PD-D200N tetramer bound to NADP+
7ZVE 2.28 Å, K403 acetylated glucose-6-phosphate dehydrogenase (G6PD)
7ZVD 2.46 Å, K89 acetylated glucose-6-phosphate dehydrogenase (G6PD) in a complex with structural NADP+
2BH9 2.5 Å, X-ray structure of a deletion variant of human glucose 6-phosphate dehydrogenase…
7SNI 2.5 Å, Structure of G6PD-D200N tetramer bound to NADP+ and G6P
7UC2 2.5 Å, Structure of G6PD-D200N tetramer bound to NADP+ with no symmetry applied
6E07 2.6 Å, Crystal structure of Canton G6PD in complex with structural NADP
5UKW 2.65 Å, Crystal structure of human Glucose 6-phosphate Dehydrogenase mutant (A277C) complexed…
7SNG 2.8 Å, structure of G6PD-WT tetramer
2BHL 2.9 Å, X-ray structure of human glucose-6-phosphate dehydrogenase (deletion variant) complexed…
7SEH 2.9 Å, Glucose-6-phosphate 1-dehydrogenase (K403QdLtL)

Browse structure collections

About this viewer

MolViewer shows 6JYU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.