6L81: Homo sapiens GCP5 N-terminus and Mozart1

Crystal structure of Homo sapiens GCP5 N-terminus and Mozart1. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Jul 2020.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,438
Mol. weight: 45.86 kDa
Released: 15 Jul 2020

Explore 6L81 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6L81 contains 17 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	14-27	14
α-helix	35-49	15
α-helix	54-56	3
α-helix	58-74	17
α-helix	78-91	14
α-helix	106-117	12

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	16-34	19
α-helix	41-52	12
α-helix	57-69	13

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	16-27	12
α-helix	35-50	16
α-helix	58-74	17
α-helix	78-92	15
α-helix	106-117	12

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	21-34	14
α-helix	41-52	12
α-helix	57-73	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-tubulin complex component 5	A, C	protein	124	Homo sapiens	Q96RT8 (AlphaFold model)
Mitotic-spindle organizing protein 1	B, D	protein	85	Homo sapiens	Q08AG7 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6L81_1 Gamma-tubulin complex component 5 (chains A, C)
GPLGSMARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLD
VNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSIKEIKTDAHYSILSLLL
CLSD

Sequence of entity 2 (B, D), FASTA

>6L81_2 Mitotic-spindle organizing protein 1 (chains B, D)
GPHMASSGGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINP
EALSSVIKELRKATEALKAAENMTS

Primary citation

Promiscuous Binding of Microprotein Mozart1 to gamma-Tubulin Complex Mediates Specific Subcellular Targeting to Control Microtubule Array Formation. Huang, T.L., Wang, H.J., Chang, Y.C. et al. Cell Rep (2020) 31:107836-107836. DOI 10.1016/j.celrep.2020.107836 · PubMed

Other PDB entries of the same protein (UniProt Q96RT8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RX1 3.57 Å, CryoEM structure of the gTuRC-CM1dim complex
9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
8Q62 3.72 Å, Early closed conformation of the g-tubulin ring complex
7AS4 4.13 Å, Recombinant human gTuRC
6V69 4.2 Å, Structures of GCP4 and GCP5 in the native human gamma-tubulin ring complex
6V6S 4.3 Å, Structure of the native human gamma-tubulin ring complex
9QVN 4.7 Å, Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex
7QJ0 5.32 Å, Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate…
9QVM 6.8 Å, Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the…
7QJ1 7.0 Å, Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly…
8VRD 7.0 Å, Rigid body fitted model for free recombinant gamma tubulin ring complex.
7QJD 7.1 Å, Structure of recombinant human gamma-Tubulin Ring Complex without actin

Browse structure collections

About this viewer

MolViewer shows 6L81 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.