Crystal structure of gelsolin G3 domain (calcium and magnesium condition). Determined by X-ray diffraction at 1.4 Å resolution. Released 1 Jan 2020.
Explore 6LJE in 3D Show helices and sheets RCSB PDB PDBe
6LJE contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 272-277 | 6 | 1 |
| β-strand | 284-289 | 6 | 1 |
| β-strand | 294 | 1 | 2 |
| α-helix | 295 | 1 | |
| α-helix | 296-298 | 3 | |
| β-strand | 304-309 | 6 | 1 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-319 | 6 | 1 |
| α-helix | 325-341 | 17 | |
| β-strand | 350-354 | 5 | 1 |
| α-helix | 360-363 | 4 | |
| β-strand | 366 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 272-277 | 6 | 3 |
| β-strand | 284-289 | 6 | 3 |
| β-strand | 294 | 1 | 4 |
| α-helix | 295 | 1 | |
| α-helix | 296-298 | 3 | |
| β-strand | 304-309 | 6 | 3 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-319 | 6 | 3 |
| α-helix | 325-341 | 17 | |
| α-helix | 348 | 1 | |
| β-strand | 349-354 | 6 | 3 |
| α-helix | 360-363 | 4 | |
| β-strand | 366 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gelsolin | A, B | protein | 101 | Homo sapiens | P06396 (AlphaFold model) |
>6LJE_1 Gelsolin (chains A, B) LAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERK AALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWR
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (GOL) are not listed.
Novel inter-domain Ca2+-binding site in the gelsolin superfamily protein fragmin. Takeda, S., Fujiwara, I., Sugimoto, Y. et al. J Muscle Res Cell Motil (2020) 41:153-162. DOI 10.1007/s10974-019-09571-5 · PubMed
Other PDB entries of the same protein (UniProt P06396 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6LJE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.