6LRY: Human endothelin ETB receptor

Crystal structure of human endothelin ETB receptor in complex with sarafotoxin S6b. Determined by X-ray diffraction at 3.0 Å resolution. Released 12 Feb 2020.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Enterobacteria phage RB59, Atractaspis engaddensis
Chains: 2
Atoms: 3,881
Mol. weight: 59.32 kDa
Released: 12 Feb 2020

Explore 6LRY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LRY contains 22 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	98-128	31
α-helix	137-163	27
α-helix	170-203	34
α-helix	217-232	16
α-helix	234-239	6
β-strand	240-247	8	1
β-strand	250-257	8	1
α-helix	264-276	13
α-helix	277-283	7
α-helix	284-1008	29
β-strand	1012-1013	2	2
β-strand	1014	1	3
β-strand	1015-1017	3	2
β-strand	1023-1026	4	2
β-strand	1029-1032	4	2
α-helix	1037-1048	12
β-strand	1055	1	3
α-helix	1058-1076	19
α-helix	1083-1088	6
α-helix	1091-1103	13
α-helix	1106-1110	5
α-helix	1113-1120	8
α-helix	1124-1131	8
α-helix	1135-1139	5
α-helix	1141-1153	13
α-helix	313-335	23
α-helix	337-349	13
α-helix	358-388	31
α-helix	391-399	9

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin receptor type B,Endolysin,Endothelin receptor type B	A	protein	504	Homo sapiens, Enterobacteria phage RB59	P24530 (AlphaFold model)
Sarafotoxin-B	B	protein	21	Atractaspis engaddensis	P13208 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6LRY_1 Endothelin receptor type B,Endolysin,Endothelin receptor type B (chains A)
GGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTL
LYIIYKNKCMRNGPNILIASLALGDLLHIVIAIPINVYKLLAEDWPFGAEMCKLVPFIQK
ASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDI
ITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLR
KNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITK
DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM
LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNDHLKQRREVAKTVFCLV
LVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCANPIALYLV
SKRFKNAFKSALCCWAQSENLYFQ

Sequence of entity 2 (B), FASTA

>6LRY_2 Sarafotoxin-B (chains B)
CSCKDMTDKECLYFCHQDVIW

Primary citation

Crystal structure of human endothelin ETBreceptor in complex with sarafotoxin S6b. Izume, T., Miyauchi, H., Shihoya, W. et al. Biochem Biophys Res Commun (2020) 528:383-388. DOI 10.1016/j.bbrc.2019.12.091 · PubMed

Other PDB entries of the same protein (UniProt P24530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IGK 2.0 Å, Crystal Structure of human ETB receptor in complex with Endothelin-3
5X93 2.2 Å, Human endothelin receptor type-B in complex with antagonist K-8794
5GLI 2.5 Å, Human endothelin receptor type-B in the ligand-free form
6IGL 2.7 Å, Crystal Structure of human ETB receptor in complex with IRL1620
6K1Q 2.7 Å, Human endothelin receptor type-B in complex with inverse agonist IRL2500
5GLH 2.8 Å, Human endothelin receptor type-B in complex with ET-1
8IY5 2.8 Å, ETB-Gi complex bound to endothelin-1
8HBD 2.99 Å, Cryo-EM structure of IRL1620-bound ETBR-Gi complex
8XVE 3.0 Å, Cryo-EM structure of ETBR bound with BQ3020
8IY6 3.13 Å, ETB-Gi complex bound to Endotheline-1, focused on receptor
8XGR 3.2 Å, ETB-eGt complex bound to endothelin-1
8XWP 3.21 Å, Cryo-EM structure of ET-1 bound ETBR-DNGI complex

Browse structure collections

About this viewer

MolViewer shows 6LRY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.