6MTV: Human Scribble PDZ1:MCC complex

Crystal structure of human Scribble PDZ1:MCC complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Aug 2019.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,575
Mol. weight: 27.16 kDa
Released: 14 Aug 2019

Explore 6MTV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MTV contains 6 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	724-732	9	1
β-strand	740-744	5	1
β-strand	752	1	2
β-strand	755	1	2
β-strand	758-763	6	1
α-helix	768-772	5
β-strand	779-783	5	1
β-strand	786-787	2	1
α-helix	793-801	9
β-strand	806-814	9	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	718-720	3
β-strand	724-731	8	3
β-strand	740-744	5	3
β-strand	758-763	6	3
α-helix	768-772	5
α-helix	778	1
β-strand	779-783	5	3
β-strand	786-787	2	3
α-helix	793-800	8
β-strand	807-814	8	3

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	826-828	3	1

Chain E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	827-828	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A, B	protein	118	Homo sapiens	Q14160 (AlphaFold model)
Colorectal mutant cancer protein	D, E	protein	8	Homo sapiens	P23508 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6MTV_1 Protein scribble homolog (chains A, B)
GSAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGI
FISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERM

Sequence of entity 2 (D, E), FASTA

>6MTV_2 Colorectal mutant cancer protein (chains D, E)
PHTNETSL

Primary citation

Structural analysis of phosphorylation-associated interactions of human MCC with Scribble PDZ domains. Caria, S., Stewart, B.Z., Jin, R. et al. FEBS J (2019) 286:4910-4925. DOI 10.1111/febs.15002 · PubMed

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…

Browse structure collections

About this viewer

MolViewer shows 6MTV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.