6MYF: Free human Scribble PDZ1 domain

Crystal structure of free human Scribble PDZ1 domain. Determined by X-ray diffraction at 1.6 Å resolution. Released 10 Apr 2019.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 796
Mol. weight: 9.9 kDa
Released: 10 Apr 2019

Explore 6MYF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MYF contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	724-732	9	1
β-strand	734	1	2
β-strand	737	1	2
β-strand	740-744	5	1
β-strand	752	1	3
β-strand	755	1	3
β-strand	758-763	6	1
α-helix	768-772	5
α-helix	778	1
β-strand	779-783	5	1
β-strand	786-787	2	1
α-helix	793-801	9
β-strand	806-814	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A	protein	95	Homo sapiens	Q14160 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MYF_1 Protein scribble homolog (chains A)
GAMGEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKL
LEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER

Primary citation

SGEF forms a complex with Scribble and Dlg1 and regulates epithelial junctions and contractility. Awadia, S., Huq, F., Arnold, T.R. et al. J Cell Biol (2019) 218:2699-2725. DOI 10.1083/jcb.201811114 · PubMed

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…
8CD3 1.9 Å, Crystal structure of human Scribble PDZ1 domain in complex with human TMIGD1

Browse structure collections

About this viewer

MolViewer shows 6MYF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.