6OX7: Non-structural protein 1

The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K. Determined by X-ray diffraction at 2.75 Å resolution. Released 22 Apr 2020.

Method: X-ray diffraction
Resolution: 2.75 Å
Organisms: Influenza A virus (strain A/Brevig Mission/1/1918 H1N1), Homo sapiens
Chains: 4
Atoms: 4,262
Mol. weight: 72.63 kDa
Released: 22 Apr 2020

Explore 6OX7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OX7 contains 15 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	88-91	4	1
α-helix	95-99	5
β-strand	107-112	6	1
β-strand	115-120	6	1
β-strand	127-137	11	1
β-strand	140-151	12	1
β-strand	156-162	7	1
α-helix	171-186	16
β-strand	191-194	4	1
α-helix	196-201	6

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	88-91	4	2
α-helix	95-99	5
β-strand	107-112	6	2
β-strand	115-120	6	2
β-strand	127-137	11	2
β-strand	140-151	12	2
β-strand	156-162	7	2
α-helix	163	1
α-helix	171-187	17
β-strand	191-194	4	2
α-helix	196-201	6

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	435-492	58
α-helix	535-561	27
α-helix	564-583	20
α-helix	588-594	7

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	435-497	63
α-helix	523-561	39
α-helix	564-583	20
α-helix	588-595	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, B	protein	145	Influenza A virus (strain A/Brevig Mission/1/1918 H1N1)	Q99AU3
Phosphatidylinositol 3-kinase regulatory subunit beta	C, D	protein	165	Homo sapiens	O00459 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6OX7_1 Non-structural protein 1 (chains A, B)
ASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLI
LLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGVLIGGLERNDNTVRVSETLQRFAWRS
SNENGRPPLPPKQKRKMARTIKSEV

Sequence of entity 2 (C, D), FASTA

>6OX7_2 Phosphatidylinositol 3-kinase regulatory subunit beta (chains C, D)
GSKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFE
EQGQTQEKSSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASD
NREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGI

Primary citation

Molecular recognition of a host protein by NS1 of pandemic and seasonal influenza A viruses. Cho, J.H., Zhao, B., Shi, J. et al. Proc Natl Acad Sci U S A (2020) 117:6550-6558. DOI 10.1073/pnas.1920582117 · PubMed

Other PDB entries of the same protein (UniProt Q99AU3), best resolution first:

5UL6 1.45 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6ATV 1.75 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6DGK 1.9 Å, Crystal Structure of the Non-Structural Protein 1 (NS1) effector domain W187A mutant…
6U28 2.95 Å, Crystal structure of 1918 NS1-ED W187A in complex with the p85-beta-iSH2 domain of human…
2N74 Solution Structure of the RNA-Binding domain of non-structural protein 1 from the 1918…
6NU0 Solution NMR structure of 1918 NS1 effector domain

Browse structure collections

About this viewer

MolViewer shows 6OX7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.