6PSU: Protein TraR

Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi2) with TraR and rpsT P2 promoter. Determined by electron microscopy at 3.9 Å resolution. Released 25 Mar 2020.

Method: Electron microscopy
Resolution: 3.9 Å
Organism: Escherichia coli
Chains: 10
Atoms: 32,167
Mol. weight: 562.9 kDa
Ligands: ZN, MG, 1N7
Released: 25 Mar 2020

Explore 6PSU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PSU contains 181 α-helices and 231 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	13	1	2
β-strand	17	1	3
β-strand	23-25	3	3
β-strand	28-31	4	2
α-helix	35-49	15
β-strand	53	1	4
β-strand	56-61	6	5
α-helix	78-85	8
β-strand	90-91	2	6
β-strand	97-105	9	5
β-strand	108-111	4	7
α-helix	112-114	3
β-strand	115	1	5
α-helix	116-118	3
β-strand	122-123	2	6
β-strand	129-133	5	7
β-strand	139-147	9	5
β-strand	149	1	4
β-strand	153	1	8
α-helix	155-158	4
β-strand	171-172	2	5
α-helix	173-174	2
β-strand	175	1	8
β-strand	180-184	5	3
β-strand	187-189	3	2
β-strand	199-201	3	2
β-strand	204-207	4	3
α-helix	213-233	21

Chain H: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	16-18	3	9
β-strand	24-26	3	9
β-strand	27	1	10
β-strand	31	1	11
α-helix	35-49	15
β-strand	56-60	5	12
β-strand	74	1	13
α-helix	78-86	9
β-strand	90-92	3	14
β-strand	97-100	4	12
β-strand	104-105	2	15
β-strand	109-110	2	16
β-strand	121-123	3	14
β-strand	131-132	2	16
β-strand	133	1	13
β-strand	139-140	2	15
β-strand	143-147	5	12
α-helix	155-157	3
β-strand	172	1	12
β-strand	180-184	5	9
β-strand	187	1	17
β-strand	190	1	18
β-strand	198	1	18
β-strand	199	1	11
β-strand	201	1	17
β-strand	202	1	10
β-strand	204-207	4	9
α-helix	213-227	15
α-helix	228-230	3

Chain I: 57 helices, 97 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	13	1	19
α-helix	19-20	2
α-helix	29-35	7
α-helix	48-56	9
β-strand	59-60	2	20
β-strand	66-75	10	20
α-helix	76-78	3
α-helix	82-88	7
β-strand	93-106	14	20
β-strand	109-116	8	20
β-strand	119-128	10	20
β-strand	143-144	2	21
α-helix	146	1
β-strand	147-148	2	22
β-strand	149-151	3	23
α-helix	152	1
β-strand	156-158	3	24
β-strand	173-176	4	24
β-strand	180	1	25
β-strand	184-187	4	24
β-strand	195-197	3	24
β-strand	204-205	2	24
α-helix	207-212	6
α-helix	217-224	8
β-strand	228-231	4	26
β-strand	239-240	2	27
β-strand	250	1	28
β-strand	255-257	3	29
β-strand	260-263	4	29
β-strand	268	1	28
α-helix	271-280	10
β-strand	284-285	2	27
β-strand	297	1	26
β-strand	301	1	30
β-strand	311	1	30
α-helix	319-328	10
β-strand	332-335	4	26
α-helix	347-353	7
α-helix	360-370	11
α-helix	378-389	12
α-helix	392-394	3
β-strand	396	1	25
α-helix	399-408	10
α-helix	422-436	15
β-strand	451-453	3	23
α-helix	456-480	25
α-helix	496-507	12
β-strand	513-514	2	21
α-helix	515	1
α-helix	520-526	7
β-strand	529	1	31
β-strand	530-531	2	22
α-helix	552-554	3
β-strand	558	1	32
β-strand	574	1	31
β-strand	575	1	32
β-strand	580-581	2	33
β-strand	587-594	8	33
β-strand	599-607	9	33
α-helix	608-611	4
β-strand	616	1	33
β-strand	633-637	5	33
β-strand	642-646	5	33
α-helix	647-649	3
β-strand	652-654	3	33
α-helix	658-660	3
α-helix	665-667	3
α-helix	671-673	3
β-strand	674	1	34
α-helix	676-686	11
β-strand	689	1	35
α-helix	690-691	2
β-strand	700	1	19
α-helix	705-710	6
β-strand	716-717	2	36
β-strand	722-727	6	37
β-strand	731-736	6	37
β-strand	749-752	4	37
β-strand	757-759	3	38
β-strand	763-765	3	38
β-strand	768-769	2	36
β-strand	776	1	37
β-strand	782-785	4	36
β-strand	789-790	2	39
β-strand	793-794	2	39
β-strand	798-801	4	40
β-strand	802-804	3	41
β-strand	815-817	3	42
β-strand	818	1	41
α-helix	820-824	5
β-strand	832	1	43
β-strand	835-836	2	44
β-strand	843	1	45
β-strand	846	1	45
β-strand	849	1	46
α-helix	859-862	4
β-strand	865	1	47
β-strand	870	1	48
β-strand	871	1	47
β-strand	877	1	49
β-strand	884	1	48
β-strand	887	1	46
β-strand	889	1	50
α-helix	895-896	2
α-helix	900-905	6
β-strand	913	1	50
β-strand	926	1	49
β-strand	927-931	5	44
β-strand	936	1	51
α-helix	940-942	3
α-helix	943-978	36
α-helix	988-991	4
α-helix	994-996	3
α-helix	1006-1037	32
β-strand	1040	1	51
α-helix	1042-1043	2
β-strand	1052-1055	4	44
β-strand	1056	1	43
β-strand	1065	1	42
β-strand	1075-1078	4	42
β-strand	1087-1088	2	52
α-helix	1092	1
β-strand	1093	1	52
α-helix	1094	1
β-strand	1096-1098	3	41
α-helix	1102-1105	4
β-strand	1108	1	34
α-helix	1110-1133	24
α-helix	1139-1149	11
α-helix	1171-1174	4
β-strand	1182	1	19
α-helix	1192-1201	10
β-strand	1209-1210	2	41
β-strand	1212-1213	2	52
α-helix	1219	1
β-strand	1220	1	52
α-helix	1221	1
β-strand	1225-1226	2	41
β-strand	1229-1232	4	40
β-strand	1235	1	35
α-helix	1239-1241	3
β-strand	1244-1246	3	53
β-strand	1251	1	54
β-strand	1252	1	55
β-strand	1258	1	54
α-helix	1266-1269	4
β-strand	1270	1	56
α-helix	1272-1280	9
α-helix	1285-1288	4
α-helix	1289-1293	5
α-helix	1298-1309	12
α-helix	1321-1332	12
β-strand	1335-1339	5	57

Chain J: 62 helices, 81 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	57
α-helix	27-33	7
β-strand	37	1	58
β-strand	44	1	59
β-strand	51	1	59
β-strand	52	1	60
β-strand	54	1	60
β-strand	58	1	60
α-helix	59-62	4
α-helix	78-80	3
α-helix	83	1
β-strand	84	1	61
α-helix	85	1
β-strand	91	1	61
α-helix	95-99	5
β-strand	103-112	10	58
α-helix	114-117	4
α-helix	132-139	8
β-strand	145	1	62
β-strand	159	1	62
α-helix	162-169	8
β-strand	179	1	62
α-helix	182-191	10
α-helix	194-206	13
α-helix	211-230	20
α-helix	234-236	3
β-strand	238-244	7	58
α-helix	245-246	2
α-helix	253	1
β-strand	254	1	63
α-helix	255	1
β-strand	260	1	63
β-strand	261-262	2	64
α-helix	264-285	22
α-helix	289-307	19
α-helix	328-330	3
α-helix	337-342	6
β-strand	345	1	56
β-strand	350-352	3	53
β-strand	355	1	65
β-strand	365-369	5	66
α-helix	370-376	7
α-helix	378-388	11
α-helix	394-403	10
α-helix	406-415	10
β-strand	421-424	4	53
α-helix	431-433	3
β-strand	434-437	4	53
β-strand	438-442	5	66
β-strand	447	1	65
α-helix	451-457	7
β-strand	467-469	3	53
α-helix	474-479	6
α-helix	480-484	5
β-strand	485	1	53
α-helix	486-488	3
β-strand	491	1	67
β-strand	498	1	67
α-helix	506-513	8
β-strand	526-527	2	68
α-helix	530-538	9
β-strand	547-554	8	68
β-strand	566-573	8	68
α-helix	574-580	7
α-helix	589-591	3
α-helix	598-612	15
α-helix	615-635	21
α-helix	641-643	3
α-helix	645-647	3
α-helix	650-669	20
α-helix	675-702	28
β-strand	706-707	2	69
β-strand	714-715	2	69
α-helix	723-725	3
α-helix	734-741	8
α-helix	769-786	18
α-helix	795-804	10
β-strand	809	1	70
β-strand	820-822	3	71
α-helix	835-839	5
β-strand	843	1	72
β-strand	844	1	71
β-strand	849	1	73
β-strand	856	1	73
β-strand	863	1	72
α-helix	866-875	10
β-strand	880-882	3	71
β-strand	894	1	70
α-helix	896-899	4
α-helix	915-924	10
α-helix	926-929	4
β-strand	951-952	2	74
β-strand	956	1	75
β-strand	957-958	2	76
β-strand	961	1	76
β-strand	965-967	3	77
β-strand	973-975	3	77
β-strand	981-985	5	76
β-strand	993-996	4	76
β-strand	1002-1003	2	77
β-strand	1011	1	75
β-strand	1015-1016	2	74
β-strand	1021	1	78
β-strand	1024	1	78
β-strand	1025	1	79
β-strand	1033-1034	2	80
β-strand	1038	1	81
β-strand	1042	1	82
β-strand	1046	1	82
β-strand	1049-1051	3	83
β-strand	1056-1058	3	83
β-strand	1077-1079	3	81
β-strand	1089	1	84
β-strand	1096	1	84
β-strand	1098-1100	3	81
β-strand	1114-1115	2	80
β-strand	1124	1	79
α-helix	1139-1144	6
β-strand	1156	1	85
β-strand	1161-1162	2	86
β-strand	1163-1165	3	87
β-strand	1173	1	88
β-strand	1175-1177	3	87
β-strand	1190	1	88
α-helix	1195-1196	2
β-strand	1203-1204	2	86
α-helix	1205	1
β-strand	1209	1	85
α-helix	1215-1216	2
α-helix	1217-1224	8
α-helix	1226-1242	17
α-helix	1251-1260	10
β-strand	1263-1266	4	89
β-strand	1279-1281	3	89
α-helix	1282-1294	13
α-helix	1298-1299	2
β-strand	1302-1304	3	89
α-helix	1309-1314	6
α-helix	1328-1337	10
β-strand	1341-1342	2	57
α-helix	1347-1353	7
α-helix	1361-1363	3
α-helix	1364-1372	9

Chain K: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-12	6
α-helix	18-31	14
α-helix	46-54	9
α-helix	61-72	12

Chain L: 36 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	24-29	6
α-helix	40-48	9
α-helix	77-83	7
α-helix	97-105	9
α-helix	110-112	3
α-helix	113-136	24
α-helix	138-152	15
β-strand	165	1	90
α-helix	214-229	16
α-helix	232-234	3
α-helix	246-249	4
α-helix	251-257	7
β-strand	259	1	90
α-helix	263-287	25
α-helix	299-303	5
α-helix	306-309	4
α-helix	319-321	3
α-helix	327-330	4
α-helix	337-351	15
α-helix	355-381	27
α-helix	384-390	7
α-helix	401-416	16
α-helix	421-423	3
α-helix	427-443	17
α-helix	454-474	21
α-helix	480-486	7
α-helix	494-498	5
α-helix	503-504	2
β-strand	505-506	2	64
α-helix	509	1
β-strand	510	1	91
α-helix	511	1
β-strand	518	1	91
α-helix	519-522	4
β-strand	524	1	55
α-helix	529-530	2
α-helix	531-549	19
α-helix	553-562	10
α-helix	573-579	7
α-helix	584-598	15
α-helix	605-608	4

Chain M: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	251-253	3
α-helix	257-259	3
α-helix	264-272	9
α-helix	278-281	4
α-helix	286-290	5
α-helix	297-309	13

Chain N: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-25	22
β-strand	36-37	2	1
β-strand	42-43	2	1
α-helix	46-51	6
α-helix	59-70	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein TraR	N	protein	72	Escherichia coli	P41065 (AlphaFold model)
DNA-directed RNA polymerase subunit alpha	G, H, M	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1430	Escherichia coli	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800
RNA polymerase sigma factor RpoD	L	protein	616	Escherichia coli	P00579
DNA (85-mer)	O	DNA	85	Escherichia coli
DNA (85-mer)	P	DNA	85	Escherichia coli

Sequence of entity 1 (N), FASTA

>6PSU_1 Protein TraR (chains N)
SDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVEC
QAYQERQRKHYA

Sequence of entity 2 (G, H, M), FASTA

>6PSU_2 DNA-directed RNA polymerase subunit alpha (chains G, H, M)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 3 (I), FASTA

>6PSU_3 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 4 (J), FASTA

>6PSU_4 DNA-directed RNA polymerase subunit beta' (chains J)
VKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNELELEVLFQGPSSGHHHHHHHHHH

Sequence of entity 5 (K), FASTA

>6PSU_5 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 6 (L), FASTA

>6PSU_6 RNA polymerase sigma factor RpoD (chains L)
SEFMEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVME
EAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEI
DIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPT
ATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKA
KGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKM
PKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQ
VKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGRE
PTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATT
ESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRK
LRHPSRSEVLRSFLDD

Sequence of entity 7 (O), FASTA

>6PSU_7 DNA (85-MER) (chains O)
GGCGGCGCTTATTTGCACAAATCCATTGACAAAAGAAGGCTAAAAGGGCATATTCCTCGG
CCTTTGAATTGTCCATATAGAACGC

Sequence of entity 8 (P), FASTA

>6PSU_8 DNA (85-MER) (chains P)
GCGTTCTATATGGACAATTCAAAGGCCGAGGAATATGCCCTTTTAGCCTTCTTTTGTCAA
TGGATTTGTGCAAATAAGCGCCGCC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
MG	Magnesium ion	Mg	1
1N7	Chapso	C32 H59 N2 O8 S	4

Primary citation

Stepwise Promoter Melting by Bacterial RNA Polymerase. Chen, J., Chiu, C., Gopalkrishnan, S. et al. Mol Cell (2020) 78:275. DOI 10.1016/j.molcel.2020.02.017 · PubMed

Other PDB entries of the same protein (UniProt P41065 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PST 3.0 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi1.5b) with TraR and…
6PSQ 3.4 Å, Escherichia coli RNA polymerase closed complex (TRPc) with TraR and rpsT P2 promoter
6PSR 3.4 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi1) with TraR and…
6PSS 3.5 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi1.5a) with TraR and…
6PSV 3.5 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TpreRPo) with TraR and…
6N57 3.7 Å, Cryo-EM structure of Escherichia coli RNAP polymerase bound with TraR in conformation I
6PSW 3.7 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPo) with TraR and…
6N58 3.78 Å, Cryo-EM structure of Escherichia coli RNAP polymerase bound with TraR in conformation II
5W1S 3.81 Å, X-ray crystal structure of Escherichia coli RNA polymerase and TraR complex

Browse structure collections

About this viewer

MolViewer shows 6PSU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.