6QVW: Free FOXO1 DNA binding domain

Name: PDB 6QVW: Solution structure of the free FOXO1 DNA binding domain
Published: 2019-09-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of the free FOXO1 DNA binding domain. Determined by solution NMR. Released 4 Sept 2019.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 930
Mol. weight: 13.21 kDa
Released: 4 Sept 2019

Explore 6QVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QVW contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	162-172	11
β-strand	177-179	3	1
α-helix	180-190	11
α-helix	192-196	5
α-helix	203-215	13
β-strand	220-223	4	1
β-strand	233-236	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Forkhead box protein O1	A	protein	119	Homo sapiens	Q12778 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6QVW_1 Forkhead box protein O1 (chains A)
GPLGSAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSI
RHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAK

Primary citation

Forkhead Domains of FOXO Transcription Factors Differ in both Overall Conformation and Dynamics. Psenakova, K., Kohoutova, K., Obsilova, V. et al. Cells (2019) 8. DOI 10.3390/cells8090966 · PubMed

Other PDB entries of the same protein (UniProt Q12778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A62 1.6 Å, Small molecule stabilizer (compound 2) for FOXO1 and 14-3-3
8A65 1.6 Å, Small molecule stabilizer (compound 3) for FOXO1 and 14-3-3
6QZS 1.9 Å, 14-3-3 sigma in complex with FOXO1 pS256 peptide
3CO6 2.1 Å, Crystal Structure of FoxO1 DBD Bound to DBE1 DNA
4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
3COA 2.2 Å, Crystal Structure of FoxO1 DBD Bound to IRE DNA
6QZR 2.3 Å, 14-3-3 sigma in complex with FOXO1 pT24 peptide
5DUI 2.31 Å, Identification of a new FoxO1 binding site that precludes CREB binding at the…
3CO7 2.91 Å, Crystal Structure of FoxO1 DBD Bound to DBE2 DNA
6LBI 3.07 Å, Crystal Structure of FOXO1-DBD homodimer bound to a palindromic DNA sequence

Browse structure collections

About this viewer

MolViewer shows 6QVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.