6SP3: Interleukin-12 subunit beta

mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 1. Determined by X-ray diffraction at 3.0 Å resolution. Released 9 Sept 2020.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 2
Atoms: 4,780
Mol. weight: 80.98 kDa
Released: 9 Sept 2020

Explore 6SP3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SP3 contains 12 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	1
β-strand	30-36	7	1
α-helix	41-43	3
β-strand	44-49	6	2
β-strand	58-62	5	1
β-strand	65-71	7	1
β-strand	74-79	6	2
α-helix	82-84	3
β-strand	86-92	7	1
β-strand	95-108	14	1
β-strand	111-112	2	1
β-strand	117-118	2	3
β-strand	127-129	3	3
β-strand	130	1	4
β-strand	136-143	8	3
β-strand	149-155	7	1
β-strand	165-167	3	3
β-strand	171-179	9	3
β-strand	182-193	12	3
α-helix	201-202	2
β-strand	206-214	9	1
β-strand	217-225	9	1
α-helix	227-230	4
β-strand	231	1	4
α-helix	233-236	4
β-strand	237-245	9	5
β-strand	248-254	7	5
β-strand	268-274	7	6
β-strand	294-296	3	6
β-strand	300-303	4	5
β-strand	310-316	7	6
α-helix	322-326	5
β-strand	327-329	3	6

Chain B: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	7
β-strand	30-36	7	7
α-helix	41-43	3
β-strand	44-49	6	8
β-strand	58-62	5	7
β-strand	68-71	4	7
β-strand	74-79	6	8
α-helix	82-84	3
β-strand	86-92	7	7
β-strand	95-108	14	7
β-strand	111-112	2	7
β-strand	117-118	2	9
β-strand	127-129	3	9
β-strand	130	1	10
β-strand	136-143	8	9
β-strand	149-155	7	7
β-strand	165-167	3	9
β-strand	171-179	9	9
β-strand	182-193	12	9
α-helix	200-202	3
β-strand	206-214	9	7
β-strand	217-225	9	7
α-helix	227-230	4
β-strand	231	1	10
α-helix	233-236	4
β-strand	237-245	9	11
β-strand	248-254	7	11
β-strand	268-275	8	12
β-strand	294-296	3	12
β-strand	300-303	4	11
β-strand	309-316	8	12
α-helix	322-326	5
β-strand	327-330	4	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit beta	A, B	protein	344	Mus musculus	P43432 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6SP3_1 Interleukin-12 subunit beta (chains A, B)
MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITW
TSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF
KNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLD
QRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQ
MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS
TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGTKHHHHHH

Primary citation

Around she goes: the structure of mouse Interleukin-12 p80. Bloch, Y., Savvides, S.N. To be published.

Other PDB entries of the same protein (UniProt P43432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CR5 2.15 Å, Murine Interleukin-12 receptor beta 1 domain 1 in complex with murine Interleukin-12 beta.
6SFF 2.4 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group I41
8CR6 2.85 Å, mouse Interleukin-12
7R3N 3.16 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 3
6SMC 3.5 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P1
8PB1 3.5 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
8ODZ 3.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
7PUR 3.9 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 2
8OE0 4.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…

Browse structure collections

About this viewer

MolViewer shows 6SP3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.