6SUF: Photorhabdus luminescens Tc holotoxin pore

Name: PDB 6SUF: Structure of Photorhabdus luminescens Tc holotoxin pore
Published: 2019-11-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Structure of Photorhabdus luminescens Tc holotoxin pore. Determined by electron microscopy at 3.4 Å resolution. Released 6 Nov 2019.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Photorhabdus luminescens
Chains: 6
Atoms: 108,112
Mol. weight: 1690.34 kDa
Released: 6 Nov 2019

Explore 6SUF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SUF contains 656 α-helices and 661 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 119 helices, 101 β-strands

Element	Residues	Length	Sheet
β-strand	103	1	1
β-strand	111	1	2
α-helix	115-126	12
α-helix	138-141	4
α-helix	145-147	3
β-strand	149	1	3
α-helix	153-156	4
β-strand	158-160	3	4
α-helix	163-175	13
α-helix	176-178	3
α-helix	182-184	3
α-helix	185-189	5
α-helix	202-213	12
α-helix	219-222	4
α-helix	225-228	4
α-helix	234-240	7
α-helix	245-252	8
α-helix	257-259	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-294	5
α-helix	306-307	2
β-strand	308-309	2	5
β-strand	312-318	7	5
β-strand	325-334	10	5
β-strand	341-349	9	6
β-strand	352-359	8	6
β-strand	367-372	6	5
β-strand	376-382	7	5
α-helix	384-386	3
β-strand	387	1	6
β-strand	391-396	6	6
α-helix	399-402	4
β-strand	406-413	8	5
β-strand	419-430	12	5
α-helix	432-434	3
α-helix	439-449	11
α-helix	454-462	9
α-helix	472-487	16
α-helix	492-498	7
α-helix	501-504	4
α-helix	514-519	6
β-strand	531	1	7
α-helix	546-553	8
α-helix	559-569	11
β-strand	581	1	7
α-helix	582-597	16
α-helix	602-611	10
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-680	16
α-helix	688-699	12
α-helix	705-718	14
α-helix	729	1
α-helix	730-734	5
α-helix	748-769	22
α-helix	773-781	9
α-helix	783-786	4
α-helix	794-795	2
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	834-838	5
α-helix	843-855	13
α-helix	864-866	3
α-helix	871-887	17
α-helix	892-895	4
α-helix	909-911	3
α-helix	912-922	11
α-helix	923-925	3
α-helix	928-953	26
α-helix	964-971	8
β-strand	982-984	3	4
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1037	10
α-helix	1041-1043	3
β-strand	1046	1	8
β-strand	1049	1	8
α-helix	1055-1064	10
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	9
β-strand	1107-1113	7	9
β-strand	1121-1127	7	9
α-helix	1128-1130	3
β-strand	1131	1	10
β-strand	1136	1	10
α-helix	1138-1140	3
β-strand	1141	1	9
α-helix	1142-1144	3
β-strand	1145-1146	2	9
α-helix	1154-1156	3
β-strand	1159-1163	5	11
β-strand	1166-1177	12	11
β-strand	1181	1	12
β-strand	1188	1	12
β-strand	1193-1202	10	11
β-strand	1203	1	13
β-strand	1209	1	13
β-strand	1213-1216	4	11
α-helix	1218-1223	6
α-helix	1231-1232	2
β-strand	1233-1238	6	14
β-strand	1239	1	15
β-strand	1244-1250	7	14
β-strand	1253	1	16
α-helix	1256-1259	4
β-strand	1265-1270	6	14
β-strand	1274-1277	4	14
α-helix	1278-1279	2
α-helix	1280-1290	11
β-strand	1296	1	16
β-strand	1301-1302	2	17
β-strand	1303-1304	2	9
β-strand	1306	1	15
β-strand	1309-1311	3	18
β-strand	1316	1	19
β-strand	1321-1324	4	18
β-strand	1331-1332	2	18
β-strand	1336	1	18
β-strand	1337	1	19
β-strand	1340-1345	6	20
β-strand	1348-1353	6	20
β-strand	1356-1360	5	18
α-helix	1367-1378	12
β-strand	1493-1504	12	18
β-strand	1507-1512	6	18
α-helix	1513-1516	4
β-strand	1517	1	21
α-helix	1520-1523	4
β-strand	1528-1531	4	18
β-strand	1532	1	21
β-strand	1535-1538	4	20
α-helix	1539-1541	3
β-strand	1545	1	18
β-strand	1548-1559	12	18
β-strand	1564-1577	14	18
β-strand	1584-1588	5	17
β-strand	1594-1597	4	17
β-strand	1602-1604	3	17
α-helix	1610-1617	8
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1634-1635	2	22
β-strand	1640-1647	8	23
α-helix	1648-1650	3
β-strand	1660-1666	7	24
β-strand	1673-1680	8	24
β-strand	1686-1693	8	23
β-strand	1705-1710	6	24
β-strand	1721-1722	2	25
β-strand	1724-1727	4	24
α-helix	1729-1731	3
β-strand	1733-1735	3	24
β-strand	1740	1	25
β-strand	1746-1750	5	23
β-strand	1755-1756	2	22
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1784	10
α-helix	1789-1796	8
β-strand	1800	1	26
β-strand	1806-1807	2	27
β-strand	1810-1811	2	27
α-helix	1812	1
β-strand	1816	1	26
α-helix	1819-1822	4
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
α-helix	1897	1
β-strand	1898	1	1
α-helix	1899	1
β-strand	1906	1	3
α-helix	1907-1910	4
β-strand	1949	1	2
α-helix	1954-1971	18
β-strand	1974	1	28
β-strand	1980	1	28
α-helix	1987-1991	5
α-helix	1992-2002	11
β-strand	2017	1	29
α-helix	2019-2104	86
α-helix	2109-2144	36
α-helix	2151-2153	3
α-helix	2155-2163	9
α-helix	2164-2169	6
α-helix	2170-2243	74
α-helix	2248-2283	36
α-helix	2294-2296	3
α-helix	2300-2303	4
α-helix	2306-2324	19
α-helix	2327-2328	2
β-strand	2329-2336	8	30
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	31
β-strand	2373-2377	5	31
β-strand	2387-2392	6	31
α-helix	2394-2396	3
α-helix	2399-2401	3
α-helix	2404-2406	3
β-strand	2410-2418	9	30
β-strand	2422-2423	2	32
β-strand	2431-2435	5	31
β-strand	2447-2450	4	31
β-strand	2456	1	30
β-strand	2468	1	29
α-helix	2469-2470	2
β-strand	2476	1	30
β-strand	2481-2486	6	31
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	30

Chain B: 118 helices, 95 β-strands

Element	Residues	Length	Sheet
β-strand	103	1	33
β-strand	111	1	34
α-helix	115-126	12
α-helix	138-141	4
β-strand	149	1	35
α-helix	152-154	3
β-strand	159-160	2	36
α-helix	163-175	13
α-helix	176-178	3
α-helix	182-184	3
α-helix	185-189	5
α-helix	190-192	3
α-helix	202-213	12
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	254-256	3
α-helix	257-259	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-286	8
α-helix	292-294	3
β-strand	309	1	37
β-strand	312-318	7	37
β-strand	325-334	10	37
β-strand	341-349	9	38
β-strand	352-359	8	38
β-strand	367-372	6	37
β-strand	376-382	7	37
β-strand	387	1	38
β-strand	390-396	7	38
α-helix	399-402	4
β-strand	406-413	8	37
β-strand	419-430	12	37
α-helix	432-434	3
α-helix	438-450	13
α-helix	454-462	9
α-helix	472-487	16
α-helix	492-497	6
β-strand	508	1	39
β-strand	511	1	39
α-helix	514-519	6
α-helix	546-554	9
α-helix	559-569	11
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-654	7
α-helix	665-677	13
α-helix	688-691	4
α-helix	693-699	7
α-helix	705-718	14
α-helix	727-735	9
α-helix	749-769	21
α-helix	773-780	8
α-helix	783-786	4
α-helix	793-795	3
α-helix	803-814	12
α-helix	815-817	3
α-helix	818-826	9
α-helix	834-839	6
α-helix	843-852	10
α-helix	864-866	3
α-helix	871-887	17
α-helix	892-898	7
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-949	22
α-helix	950-954	5
α-helix	964-971	8
β-strand	982-983	2	36
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1064	10
α-helix	1071-1089	19
β-strand	1092-1098	7	40
β-strand	1107-1113	7	40
β-strand	1121-1127	7	40
α-helix	1128-1130	3
β-strand	1131	1	41
β-strand	1136	1	41
β-strand	1141	1	40
β-strand	1145-1146	2	40
α-helix	1154-1156	3
β-strand	1159-1163	5	42
β-strand	1166-1172	7	42
β-strand	1175-1177	3	43
β-strand	1193-1195	3	43
β-strand	1197-1202	6	42
β-strand	1203	1	44
β-strand	1209	1	44
α-helix	1210-1212	3
β-strand	1213-1216	4	42
α-helix	1218-1221	4
β-strand	1233-1238	6	45
β-strand	1239	1	46
β-strand	1245-1250	6	45
α-helix	1256-1259	4
β-strand	1265-1269	5	45
β-strand	1275-1277	3	45
α-helix	1280-1290	11
β-strand	1300-1301	2	47
β-strand	1303	1	40
β-strand	1306	1	46
β-strand	1309-1311	3	48
β-strand	1316	1	49
β-strand	1321-1323	3	48
β-strand	1324	1	50
β-strand	1331-1332	2	50
β-strand	1336-1345	10	50
β-strand	1348-1360	13	50
α-helix	1367-1377	11
β-strand	1493	1	51
α-helix	1495-1497	3
β-strand	1499-1504	6	48
β-strand	1507-1512	6	48
α-helix	1513-1516	4
β-strand	1517	1	52
α-helix	1520-1523	4
β-strand	1528-1531	4	50
β-strand	1532	1	52
β-strand	1535-1538	4	50
α-helix	1539-1541	3
α-helix	1542-1544	3
β-strand	1545	1	48
β-strand	1548-1558	11	48
β-strand	1559	1	51
β-strand	1564-1577	14	48
α-helix	1582-1584	3
β-strand	1585-1588	4	47
β-strand	1594-1597	4	47
β-strand	1602-1604	3	47
α-helix	1610-1617	8
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1634-1635	2	53
β-strand	1640-1647	8	54
α-helix	1648-1650	3
β-strand	1660-1666	7	55
β-strand	1674-1680	7	55
β-strand	1686-1693	8	54
β-strand	1705-1710	6	55
β-strand	1724-1727	4	55
α-helix	1729-1731	3
β-strand	1733-1735	3	55
β-strand	1746-1750	5	54
β-strand	1755-1756	2	53
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1796	8
β-strand	1800	1	56
β-strand	1806-1807	2	57
β-strand	1810-1811	2	57
α-helix	1812	1
β-strand	1816	1	56
α-helix	1819-1822	4
α-helix	1837-1839	3
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
α-helix	1897	1
β-strand	1898	1	33
α-helix	1899	1
β-strand	1906	1	35
α-helix	1907-1910	4
β-strand	1949	1	34
α-helix	1954-1971	18
β-strand	1974	1	58
β-strand	1980	1	58
α-helix	1987-1990	4
α-helix	1992-2003	12
α-helix	2010-2014	5
β-strand	2017	1	59
α-helix	2019-2104	86
α-helix	2109-2138	30
α-helix	2141-2144	4
α-helix	2151-2153	3
α-helix	2156-2162	7
α-helix	2163-2168	6
α-helix	2169-2243	75
α-helix	2248-2283	36
α-helix	2294-2296	3
α-helix	2300-2303	4
α-helix	2306-2324	19
α-helix	2327-2328	2
β-strand	2329-2336	8	60
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	61
β-strand	2373-2377	5	61
β-strand	2387-2392	6	61
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	60
β-strand	2422-2423	2	62
β-strand	2431-2435	5	61
β-strand	2447-2450	4	61
β-strand	2456	1	60
β-strand	2468	1	59
α-helix	2469-2470	2
β-strand	2476	1	60
β-strand	2481-2486	6	61
α-helix	2500-2503	4
β-strand	2508-2515	8	60

Chain C: 119 helices, 100 β-strands

Element	Residues	Length	Sheet
β-strand	103	1	63
β-strand	111	1	64
α-helix	115-126	12
α-helix	138-141	4
α-helix	145-147	3
β-strand	149	1	65
α-helix	153-156	4
β-strand	159-160	2	66
α-helix	163-175	13
α-helix	176-178	3
α-helix	183-186	4
α-helix	190-192	3
α-helix	202-213	12
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	254-255	2
α-helix	257-259	3
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-295	6
β-strand	308-309	2	67
β-strand	312-318	7	67
β-strand	325-334	10	67
β-strand	341-349	9	68
β-strand	352-359	8	68
β-strand	367-372	6	67
β-strand	376-382	7	67
α-helix	384-386	3
β-strand	387	1	68
α-helix	390	1
β-strand	391-396	6	68
α-helix	399-402	4
β-strand	406-413	8	67
β-strand	419-421	3	67
β-strand	424-430	7	67
α-helix	432-434	3
α-helix	438-450	13
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-498	7
α-helix	501-504	4
α-helix	514-515	2
α-helix	516-520	5
β-strand	531	1	69
β-strand	536	1	70
β-strand	544	1	70
α-helix	547-555	9
α-helix	559-569	11
β-strand	581	1	69
α-helix	582-596	15
α-helix	602-611	10
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-678	14
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-735	9
β-strand	739	1	71
β-strand	742	1	71
α-helix	748-768	21
α-helix	775-781	7
α-helix	783-785	3
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-825	8
α-helix	834-838	5
α-helix	843-853	11
α-helix	864-866	3
α-helix	871-886	16
α-helix	890-898	9
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-949	22
α-helix	950-954	5
α-helix	964-971	8
β-strand	982-983	2	66
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1065	11
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	72
β-strand	1107-1113	7	72
β-strand	1121-1127	7	72
α-helix	1128-1130	3
β-strand	1131	1	73
β-strand	1136	1	73
β-strand	1141	1	72
α-helix	1142-1144	3
β-strand	1145-1146	2	72
α-helix	1154-1156	3
β-strand	1158-1163	6	74
β-strand	1166-1177	12	74
β-strand	1193-1202	10	74
β-strand	1203	1	75
β-strand	1209	1	75
α-helix	1211-1212	2
β-strand	1213-1216	4	74
α-helix	1218-1222	5
α-helix	1231-1232	2
β-strand	1233-1238	6	76
β-strand	1239	1	77
β-strand	1245-1250	6	76
α-helix	1257-1259	3
β-strand	1264-1269	6	76
β-strand	1275-1277	3	76
α-helix	1278-1279	2
α-helix	1280-1290	11
β-strand	1296	1	78
β-strand	1299	1	78
β-strand	1300-1301	2	79
β-strand	1303-1304	2	72
β-strand	1306	1	77
β-strand	1309-1311	3	80
β-strand	1316	1	81
β-strand	1321-1324	4	80
β-strand	1331-1336	6	80
β-strand	1337	1	81
β-strand	1340-1345	6	82
β-strand	1348-1353	6	82
β-strand	1356-1360	5	80
α-helix	1367-1378	12
β-strand	1493-1504	12	80
β-strand	1507-1512	6	80
α-helix	1513-1516	4
α-helix	1520-1523	4
β-strand	1528-1531	4	80
β-strand	1535-1538	4	82
α-helix	1539-1541	3
α-helix	1542-1544	3
β-strand	1545	1	80
β-strand	1548-1559	12	80
β-strand	1564-1577	14	80
α-helix	1582-1584	3
β-strand	1585-1588	4	79
β-strand	1594-1597	4	79
β-strand	1602-1604	3	79
α-helix	1610-1619	10
α-helix	1621-1624	4
α-helix	1628-1631	4
β-strand	1633-1635	3	83
β-strand	1640-1647	8	84
α-helix	1648-1650	3
β-strand	1660-1666	7	85
β-strand	1673-1680	8	85
β-strand	1686-1693	8	84
β-strand	1705-1710	6	85
β-strand	1711	1	86
β-strand	1713	1	86
β-strand	1721-1722	2	87
β-strand	1724-1727	4	85
α-helix	1729-1731	3
β-strand	1733-1735	3	85
β-strand	1740	1	87
β-strand	1746-1750	5	84
β-strand	1755-1757	3	83
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1796	8
β-strand	1800	1	88
β-strand	1806-1807	2	89
β-strand	1810-1811	2	89
α-helix	1812	1
β-strand	1816	1	88
α-helix	1819-1822	4
α-helix	1837-1840	4
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1898	1	63
β-strand	1906	1	65
α-helix	1907-1910	4
β-strand	1949	1	64
α-helix	1954-1971	18
β-strand	1974	1	90
β-strand	1980	1	90
α-helix	1987-1990	4
α-helix	1992-2003	12
α-helix	2010-2013	4
β-strand	2017	1	91
α-helix	2019-2104	86
α-helix	2109-2144	36
α-helix	2155-2161	7
α-helix	2162-2168	7
α-helix	2169-2243	75
α-helix	2248-2283	36
α-helix	2300-2303	4
α-helix	2306-2324	19
α-helix	2327-2328	2
β-strand	2329-2336	8	92
α-helix	2337-2341	5
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	93
β-strand	2373-2377	5	93
β-strand	2387-2392	6	93
α-helix	2393-2396	4
α-helix	2398-2400	3
α-helix	2404-2406	3
β-strand	2410-2418	9	92
β-strand	2431-2435	5	93
β-strand	2447-2450	4	93
β-strand	2456	1	92
β-strand	2468	1	91
α-helix	2469-2470	2
β-strand	2476	1	92
β-strand	2481-2486	6	93
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	92

Chain D: 116 helices, 95 β-strands

Element	Residues	Length	Sheet
β-strand	103	1	94
β-strand	111	1	95
α-helix	115-126	12
α-helix	138-141	4
α-helix	145-147	3
β-strand	149	1	96
α-helix	153-156	4
β-strand	159-160	2	97
α-helix	163-174	12
α-helix	176-178	3
α-helix	183-186	4
α-helix	202-213	12
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	257-259	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-286	8
α-helix	290-293	4
β-strand	308-309	2	98
β-strand	312-318	7	98
β-strand	325-334	10	98
β-strand	341-349	9	99
β-strand	352-359	8	99
β-strand	367-372	6	98
β-strand	376-382	7	98
α-helix	385-386	2
β-strand	387	1	99
β-strand	390-396	7	99
α-helix	399-402	4
β-strand	406-413	8	98
β-strand	419-430	12	98
α-helix	438-449	12
α-helix	454-461	8
α-helix	472-487	16
α-helix	492-497	6
α-helix	501-504	4
β-strand	508	1	100
β-strand	511	1	100
α-helix	514-515	2
α-helix	516-520	5
α-helix	546-555	10
α-helix	559-569	11
α-helix	584-597	14
α-helix	602-611	10
α-helix	624-644	21
α-helix	648-654	7
α-helix	665-677	13
α-helix	688-691	4
α-helix	693-695	3
α-helix	705-718	14
α-helix	727-734	8
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-785	3
α-helix	793-795	3
α-helix	798-812	15
α-helix	815-817	3
α-helix	818-826	9
α-helix	834-839	6
α-helix	843-855	13
α-helix	864-866	3
α-helix	871-887	17
α-helix	892-898	7
α-helix	909-911	3
α-helix	912-922	11
α-helix	923-925	3
α-helix	928-953	26
α-helix	964-971	8
β-strand	982-983	2	97
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1064	10
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	101
β-strand	1107-1113	7	101
β-strand	1121-1127	7	101
α-helix	1128-1130	3
β-strand	1131	1	102
β-strand	1136	1	102
β-strand	1141	1	101
α-helix	1142-1144	3
β-strand	1145-1147	3	101
α-helix	1154-1156	3
β-strand	1158-1163	6	103
β-strand	1166-1177	12	103
β-strand	1193-1202	10	103
β-strand	1203	1	104
β-strand	1209	1	104
α-helix	1211-1212	2
β-strand	1213-1216	4	103
α-helix	1218-1223	6
α-helix	1231-1232	2
β-strand	1233-1238	6	105
β-strand	1239	1	106
β-strand	1245-1250	6	105
α-helix	1256-1259	4
β-strand	1265-1269	5	105
β-strand	1275-1278	4	105
α-helix	1280-1290	11
β-strand	1300-1301	2	107
β-strand	1303	1	101
β-strand	1306	1	106
β-strand	1309-1311	3	108
β-strand	1316	1	109
β-strand	1321-1323	3	108
β-strand	1324	1	110
β-strand	1331-1332	2	110
β-strand	1336	1	110
β-strand	1337	1	109
β-strand	1340-1345	6	111
β-strand	1348-1353	6	111
β-strand	1356-1360	5	110
α-helix	1367-1378	12
β-strand	1493-1504	12	108
β-strand	1507-1512	6	108
α-helix	1513-1516	4
α-helix	1520-1523	4
β-strand	1527-1531	5	110
β-strand	1535-1538	4	111
β-strand	1545	1	108
β-strand	1548-1559	12	108
β-strand	1564-1577	14	108
α-helix	1582-1584	3
β-strand	1585-1588	4	107
β-strand	1594-1597	4	107
β-strand	1602-1604	3	107
α-helix	1610-1617	8
α-helix	1621-1624	4
α-helix	1628-1631	4
β-strand	1633-1635	3	112
β-strand	1640-1647	8	113
α-helix	1648-1650	3
β-strand	1660-1666	7	114
β-strand	1673-1680	8	114
β-strand	1686-1693	8	113
β-strand	1705-1710	6	114
β-strand	1721-1722	2	115
β-strand	1724-1727	4	114
α-helix	1729-1731	3
β-strand	1733-1735	3	114
β-strand	1740	1	115
β-strand	1746-1749	4	113
β-strand	1755-1757	3	112
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1796	8
β-strand	1800	1	116
β-strand	1806-1807	2	117
β-strand	1810-1811	2	117
α-helix	1812	1
β-strand	1816	1	116
α-helix	1819-1822	4
α-helix	1831-1832	2
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1898	1	94
β-strand	1906	1	96
α-helix	1907-1910	4
β-strand	1949	1	95
α-helix	1954-1971	18
β-strand	1974	1	118
β-strand	1980	1	118
α-helix	1987-1990	4
α-helix	1992-2004	13
β-strand	2017	1	119
α-helix	2019-2104	86
α-helix	2109-2138	30
α-helix	2141-2144	4
α-helix	2151-2153	3
α-helix	2155-2163	9
α-helix	2164-2168	5
α-helix	2169-2243	75
α-helix	2248-2283	36
α-helix	2294-2296	3
α-helix	2300-2303	4
α-helix	2306-2322	17
α-helix	2327-2328	2
β-strand	2329-2336	8	120
α-helix	2337-2341	5
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	121
β-strand	2373-2377	5	121
β-strand	2387-2392	6	121
α-helix	2393-2395	3
α-helix	2399-2401	3
α-helix	2404-2406	3
β-strand	2410-2418	9	120
β-strand	2421	1	122
β-strand	2431-2435	5	121
β-strand	2447-2450	4	121
β-strand	2456	1	120
β-strand	2468	1	119
α-helix	2469-2470	2
β-strand	2476	1	120
β-strand	2481-2486	6	121
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2504	1	122
β-strand	2508-2515	8	120

Chain E: 117 helices, 99 β-strands

Element	Residues	Length	Sheet
β-strand	103	1	123
β-strand	111	1	124
α-helix	115-126	12
α-helix	138-141	4
α-helix	145-147	3
β-strand	149	1	125
α-helix	153-156	4
β-strand	159-160	2	126
α-helix	163-175	13
α-helix	176-178	3
α-helix	182-184	3
α-helix	185-190	6
α-helix	202-213	12
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	257-259	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-293	4
α-helix	306-308	3
β-strand	309	1	127
β-strand	312-318	7	127
β-strand	325-334	10	127
β-strand	341-349	9	128
β-strand	352-359	8	128
β-strand	367-372	6	127
β-strand	376-382	7	127
α-helix	384-386	3
β-strand	387	1	128
β-strand	391-396	6	128
α-helix	399-402	4
β-strand	406-413	8	127
β-strand	419-420	2	127
β-strand	423-430	8	127
α-helix	432-434	3
α-helix	438-449	12
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-497	6
α-helix	501-504	4
α-helix	514-519	6
β-strand	531	1	129
α-helix	546-555	10
α-helix	559-569	11
β-strand	581	1	129
α-helix	582-596	15
α-helix	602-612	11
α-helix	624-644	21
α-helix	648-654	7
α-helix	665-677	13
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
β-strand	739	1	130
β-strand	742	1	130
α-helix	748-769	22
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	835-838	4
α-helix	843-855	13
α-helix	864-866	3
α-helix	871-887	17
α-helix	890-895	6
α-helix	909-911	3
α-helix	912-922	11
α-helix	923-925	3
α-helix	928-949	22
α-helix	950-954	5
α-helix	964-971	8
β-strand	982-983	2	126
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1037	10
α-helix	1041-1043	3
α-helix	1055-1064	10
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	131
β-strand	1107-1113	7	131
β-strand	1121-1127	7	131
α-helix	1128-1130	3
β-strand	1131	1	132
β-strand	1136	1	132
α-helix	1138-1140	3
β-strand	1141	1	131
β-strand	1145-1147	3	131
β-strand	1159-1163	5	133
β-strand	1166-1177	12	133
β-strand	1193-1202	10	133
β-strand	1203	1	134
β-strand	1209	1	134
β-strand	1213-1216	4	133
α-helix	1218-1221	4
α-helix	1231-1232	2
β-strand	1233-1238	6	135
β-strand	1239	1	136
β-strand	1245-1250	6	135
α-helix	1256-1259	4
β-strand	1265-1269	5	135
β-strand	1275-1277	3	135
α-helix	1278-1279	2
α-helix	1280-1287	8
β-strand	1296	1	137
β-strand	1299	1	137
β-strand	1300-1301	2	138
β-strand	1303	1	131
β-strand	1306	1	136
β-strand	1309-1311	3	139
β-strand	1316	1	140
β-strand	1321-1324	4	139
β-strand	1331-1332	2	139
β-strand	1336	1	139
β-strand	1337	1	140
β-strand	1340-1345	6	141
β-strand	1348-1353	6	141
β-strand	1356-1360	5	139
α-helix	1367-1377	11
β-strand	1493-1504	12	139
β-strand	1507-1512	6	139
α-helix	1513-1516	4
α-helix	1520-1522	3
β-strand	1528-1531	4	139
β-strand	1535-1538	4	141
α-helix	1539-1541	3
β-strand	1545	1	139
β-strand	1548-1559	12	139
β-strand	1564-1577	14	139
β-strand	1585-1588	4	138
β-strand	1594-1597	4	138
β-strand	1602-1604	3	138
α-helix	1610-1618	9
α-helix	1621-1624	4
α-helix	1628-1631	4
β-strand	1633-1635	3	142
β-strand	1640-1647	8	143
α-helix	1648-1650	3
β-strand	1660-1666	7	144
β-strand	1674-1680	7	144
β-strand	1686-1693	8	143
β-strand	1705-1710	6	144
β-strand	1711	1	145
β-strand	1713	1	145
β-strand	1724-1727	4	144
α-helix	1729-1731	3
β-strand	1733-1735	3	144
β-strand	1746-1749	4	143
β-strand	1755-1757	3	142
α-helix	1765-1768	4
α-helix	1769-1774	6
α-helix	1775-1785	11
α-helix	1789-1796	8
β-strand	1800	1	146
β-strand	1806-1807	2	147
β-strand	1810-1811	2	147
α-helix	1812	1
β-strand	1816	1	146
α-helix	1819-1822	4
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
α-helix	1897	1
β-strand	1898	1	123
α-helix	1899	1
β-strand	1906	1	125
α-helix	1907-1910	4
β-strand	1949	1	124
α-helix	1954-1971	18
β-strand	1974	1	148
β-strand	1980	1	148
α-helix	1987-1990	4
α-helix	1992-2003	12
α-helix	2004-2007	4
β-strand	2017	1	149
α-helix	2019-2104	86
α-helix	2109-2137	29
α-helix	2141-2146	6
α-helix	2151-2153	3
α-helix	2155-2162	8
α-helix	2163-2168	6
α-helix	2169-2241	73
α-helix	2248-2283	36
α-helix	2300-2303	4
α-helix	2306-2322	17
α-helix	2326-2328	3
β-strand	2329-2336	8	150
α-helix	2337-2342	6
α-helix	2353-2362	10
β-strand	2367-2370	4	151
β-strand	2373-2377	5	151
β-strand	2387-2392	6	151
α-helix	2393-2395	3
α-helix	2399-2401	3
α-helix	2404-2406	3
β-strand	2410-2418	9	150
β-strand	2421	1	152
β-strand	2431-2435	5	151
β-strand	2447-2450	4	151
β-strand	2456	1	150
β-strand	2468	1	149
α-helix	2469-2470	2
β-strand	2476	1	150
β-strand	2481-2486	6	151
α-helix	2497-2500	4
α-helix	2501-2503	3
β-strand	2504	1	152
β-strand	2508-2515	8	150

Chain F: 67 helices, 171 β-strands

Element	Residues	Length	Sheet
α-helix	13-16	4
β-strand	27-28	2	153
β-strand	38-42	5	153
β-strand	56-60	5	153
β-strand	72-73	2	153
β-strand	78-81	4	154
β-strand	96-97	2	154
α-helix	102	1
β-strand	103	1	154
β-strand	104-116	13	155
β-strand	119-132	14	155
β-strand	134	1	155
β-strand	140-146	7	155
β-strand	154-158	5	155
β-strand	161	1	155
β-strand	164-167	4	155
α-helix	171-173	3
β-strand	174-176	3	154
β-strand	184-188	5	154
β-strand	189-193	5	155
β-strand	199-206	8	155
α-helix	214-219	6
β-strand	227-236	10	155
α-helix	246-248	3
α-helix	249-251	3
α-helix	253-255	3
β-strand	256-263	8	155
α-helix	274-276	3
α-helix	284-286	3
β-strand	290-292	3	156
β-strand	299-301	3	156
β-strand	307-312	6	155
α-helix	314-317	4
β-strand	328-338	11	155
β-strand	345-354	10	155
β-strand	360-362	3	155
α-helix	364-365	2
β-strand	366-370	5	155
β-strand	380-383	4	157
β-strand	396-399	4	158
α-helix	401-403	3
β-strand	408-412	5	158
β-strand	417-420	4	158
β-strand	422-425	4	159
β-strand	432-435	4	159
β-strand	439-440	2	158
β-strand	444-445	2	62
β-strand	451-454	4	160
β-strand	463-468	6	160
β-strand	471-476	6	160
β-strand	477	1	161
α-helix	478	1
β-strand	483	1	161
α-helix	484-486	3
β-strand	487-488	2	160
β-strand	492-493	2	32
α-helix	494-497	4
β-strand	502-504	3	162
α-helix	512	1
β-strand	513-517	5	162
β-strand	521-525	5	162
β-strand	527	1	163
β-strand	532	1	163
α-helix	533-535	3
β-strand	536-539	4	162
α-helix	540-541	2
β-strand	556-560	5	164
β-strand	569-573	5	164
β-strand	578-581	4	164
β-strand	583	1	165
β-strand	589	1	165
β-strand	593-595	3	164
α-helix	607-609	3
β-strand	610-613	4	166
β-strand	622-627	6	166
β-strand	630-634	5	166
β-strand	636	1	167
β-strand	642	1	167
α-helix	643-645	3
β-strand	646-649	4	166
α-helix	650-651	2
β-strand	661-665	5	157
β-strand	674-679	6	157
β-strand	685-690	6	157
β-strand	699-703	5	155
β-strand	708-716	9	155
α-helix	717-729	13
β-strand	738	1	155
β-strand	744-753	10	155
β-strand	758-771	14	155
β-strand	778-791	14	155
α-helix	792-793	2
β-strand	804-810	7	155
α-helix	821-824	4
α-helix	826-827	2
α-helix	831-833	3
β-strand	838-843	6	155
β-strand	846-849	4	155
α-helix	855-863	9
β-strand	869-876	8	155
β-strand	888-900	13	155
α-helix	907	1
β-strand	908-920	13	155
β-strand	929-938	10	155
β-strand	944-951	8	155
α-helix	952-955	4
α-helix	968	1
α-helix	973-975	3
α-helix	979-981	3
β-strand	983-996	14	155
β-strand	1001-1016	16	155
α-helix	1018-1020	3
α-helix	1028-1031	4
α-helix	1044	1
β-strand	1045-1055	11	155
α-helix	1062-1063	2
β-strand	1071-1080	10	155
α-helix	1085-1088	4
α-helix	1094-1103	10
β-strand	1106-1109	4	155
β-strand	1121-1126	6	155
β-strand	1128-1131	4	168
β-strand	1140-1144	5	168
β-strand	1152-1156	5	168
β-strand	1163-1167	5	168
β-strand	1173-1179	7	168
β-strand	1184-1189	6	168
β-strand	1194-1200	7	168
β-strand	1206-1214	9	168
β-strand	1219-1221	3	168
α-helix	1223-1224	2
α-helix	1236-1240	5
β-strand	1249	1	168
β-strand	1251-1255	5	169
β-strand	1262	1	170
α-helix	1265-1271	7
α-helix	1275-1281	7
β-strand	1285	1	171
β-strand	1290	1	170
β-strand	1291	1	171
α-helix	1292	1
α-helix	1293-1301	9
α-helix	1307-1313	7
β-strand	1322-1328	7	169
β-strand	1339-1346	8	169
β-strand	1352-1359	8	169
β-strand	1362-1364	3	172
β-strand	1365	1	169
β-strand	1366-1367	2	172
β-strand	1373-1380	8	172
β-strand	1383-1387	5	169
β-strand	1390-1392	3	173
β-strand	1398-1402	5	173
α-helix	1403-1404	2
β-strand	1405-1407	3	169
α-helix	1412-1414	3
α-helix	1415-1421	7
β-strand	1426-1431	6	173
β-strand	1437-1441	5	173
β-strand	1447-1452	6	173
β-strand	1456-1460	5	173
α-helix	1466-1468	3
α-helix	1485-1488	4
β-strand	1493-1497	5	173
β-strand	1503-1510	8	173
β-strand	1519-1527	9	173
β-strand	1533-1537	5	173
α-helix	1539-1545	7
α-helix	1551-1553	3
β-strand	1555-1559	5	173
β-strand	1565-1570	6	173
β-strand	1574-1580	7	173
β-strand	1586-1590	5	173
β-strand	1596-1601	6	173
β-strand	1610-1616	7	173
β-strand	1624-1631	8	173
α-helix	1636-1640	5
β-strand	1647-1651	5	173
β-strand	1655-1662	8	173
β-strand	1668-1676	9	173
α-helix	1677	1
α-helix	1689-1693	5
β-strand	1696-1707	12	173
β-strand	1713-1717	5	173
β-strand	1723-1728	6	173
β-strand	1734-1740	7	173
α-helix	1745	1
β-strand	1746-1755	10	173
β-strand	1761-1766	6	173
β-strand	1771-1777	7	173
β-strand	1782-1790	9	173
β-strand	1795-1804	10	173
β-strand	1810-1815	6	173
α-helix	1818-1819	2
α-helix	1829-1831	3
β-strand	1832-1833	2	173
β-strand	1834-1836	3	174
β-strand	1842-1850	9	174
α-helix	1860-1863	4
β-strand	1864	1	175
α-helix	1866-1868	3
β-strand	1872-1881	10	174
β-strand	1887-1893	7	174
β-strand	1894	1	176
β-strand	1899	1	176
β-strand	1902-1904	3	174
β-strand	1905-1907	3	177
β-strand	1914-1916	3	177
α-helix	1926-1929	4
β-strand	1930	1	178
β-strand	1935	1	179
β-strand	1936	1	178
β-strand	1938	1	180
β-strand	1944	1	180
β-strand	1945-1947	3	175
β-strand	1953-1959	7	175
α-helix	1966-1967	2
β-strand	1968-1974	7	175
β-strand	1980-1986	7	175
β-strand	1995-2001	7	175
β-strand	2004-2010	7	175
β-strand	2015-2024	10	175
β-strand	2032-2039	8	175
β-strand	2049-2055	7	175
β-strand	2061-2065	5	175
β-strand	2071-2077	7	175
β-strand	2083-2088	6	175
α-helix	2091-2094	4
β-strand	2099-2101	3	181
β-strand	2104-2106	3	181
α-helix	2111	1
β-strand	2112-2114	3	181
β-strand	2117-2120	4	181
β-strand	2125-2126	2	181
β-strand	2128	1	179
α-helix	2129-2131	3
α-helix	2144-2146	3
α-helix	2154-2156	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TcdA1	A, B, C, D, E	protein	2516	Photorhabdus luminescens	Q9RN43
TcdB2,TccC3	F	protein	2439	Photorhabdus luminescens	Q8GF97 (AlphaFold model), Q8GF99

Sequence of entity 1 (A, B, C, D, E), FASTA

>6SUF_1 TcdA1 (chains A, B, C, D, E)
MNESVKEIPDVLKSQCGFNCLTDISHSSFNEFRQQVSEHLSWSETHDLYHDAQQAQKDNR
LYEARILKRANPQLQNAVHLAILAPNAELIGYNNQFSGRASQYVAPGTVSSMFSPAAYLT
ELYREARNLHASDSVYYLDTRRPDLKSMALSQQNMDIELSTLSLSNELLLESIKTESKLE
NYTKVMEMLSTFRPSGATPYHDAYENVREVIQLQDPGLEQLNASPAIAGLMHQASLLGIN
ASISPELFNILTEEITEGNAEELYKKNFGNIEPASLAMPEYLKRYYNLSDEELSQFIGKA
SNFGQQEYSNNQLITPVVNSSDGTVKVYRITREYTTNAYQMDVELFPFGGENYRLDYKFK
NFYNASYLSIKLNDKRELVRTEGAPQVNIEYSANITLNTADISQPFEIGLTRVLPSGSWA
YAAAKFTVEEYNQYSFLLKLNKAIRLSRATELSPTILEGIVRSVNLQLDINTDVLGKVFL
TKYYMQRYAIHAETALILCNAPISQRSYDNQPSQFDRLFNTPLLNGQYFSTGDEEIDLNS
GSTGDWRKTILKRAFNIDDVSLFRLLKITDHDNKDGKIKNNLKNLSNLYIGKLLADIHQL
TIDELDLLLIAVGEGKTNLSAISDKQLATLIRKLNTITSWLHTQKWSVFQLFIMTSTSYN
KTLTPEIKNLLDTVYHGLQGFDKDKADLLHVMAPYIAATLQLSSENVAHSVLLWADKLQP
GDGAMTAEKFWDWLNTKYTPGSSEAVETQEHIVQYCQALAQLEMVYHSTGINENAFRLFV
TKPEMFGAATGAAPAHDALSLIMLTRFADWVNALGEKASSVLAAFEANSLTAEQLADAMN
LDANLLLQASIQAQNHQHLPPVTPENAFSCWTSINTILQWVNVAQQLNVAPQGVSALVGL
DYIESMKETPTYAQWENAAGVLTAGLNSQQANTLHAFLDESRSAALSTYYIRQVAKAAAA
IKSRDDLYQYLLIDNQVSAAIKTTRIAEAIASIQLYVNRALENVEENANSGVISRQFFID
WDKYNKRYSTWAGVSQLVYYPENYIDPTMRIGQTKMMDALLQSVSQSQLNADTVEDAFMS
YLTSFEQVANLKVISAYHDNINNDQGLTYFIGLSETDAGEYYWRSVDHSKFNDGKFAANA
WSEWHKIDCPINPYKSTIRPVIYKSRLYLLWLEQKEITKQTGNSKDGYQTETDYRYELKL
AHIRYDGTWNTPITFDVNKKISELKLEKNRAPGLYCAGYQGEDTLLVMFYNQQDTLDSYK
NASMQGLYIFADMASKDMTPEQSNVYRDNSYQQFDTNNVRRVNNRYAEDYEIPSSVSSRK
DYGWGDYYLSMVYNGDIPTINYKAASSDLKIYISPKLRIIHNGYEGQKRNQCNLMNKYGK
LGDKFIVYTSLGVNPNNSSNKLMFYPVYQYSGNTSGLNQGRLLFHRDTTYPSKVEAWIPG
AKRSLTNQNAAIGDDYATDSLNKPDDLKQYIFMTDSKGTATDVSGPVEINTAISPAKVQI
IVKAGGKEQTFTADKDVSIQPSPSFDEMNYQFNALEIDGSGLNFINNSASIDVTFTAFAE
DGRKLGYESFSIPVTLKVSTDNALTLHHNENGAQYMQWQSYRTRLNTLFARQLVARATTG
IDTILSMETQNIQEPQLGKGFYATFVIPPYNLSTHGDERWFKLYIKHVVDNNSHIIYSGQ
LTDTNINITLFIPLDDVPLNQDYHAKVYMTFKKSPSDGTWWGPHFVRDDKGIVTINPKSI
LTHFESVNVLNNISSEPMDFSGANSLYFWELFYYTPMLVAQRLLHEQNFDEANRWLKYVW
SPSGYIVHGQIQNYQWNVRPLLEDTSWNSDPLDSVDPDAVAQHDPMHYKVSTFMRTLDLL
IARGDHAYRQLERDTLNEAKMWYMQALHLLGDKPYLPLSTTWSDPRLDRAADITTQNAHD
SAIVALRQNIPTPAPLSLRSANTLTDLFLPQINEVMMNYWQTLAQRVYNLRHNLSIDGQP
LYLPIYATPADPKALLSAAVATSQGGGKLPESFMSLWRFPHMLENARGMVSQLTQFGSTL
QNIIERQDAEALNALLQNQAAELILTNLSIQDKTIEELDAEKTVLEKSKAGAQSRFDSYG
KLYDENINAGENQAMTLRASAAGLTTAVQASRLAGAAADLVPNIFGFAGGGSRWGAIAEA
TGYVMEFSANVMNTEADKISQSETYRRRRQEWEIQRNNAEAELKQIDAQLKSLAVRREAA
VLQKTSLKTQQEQTQSQLAFLQRKFSNQALYNWLRGRLAAIYFQFYDLAVARCLMAEQAY
RWELNDDSARFIKPGAWQGTYAGLLAGETLMLSLAQMEDAHLKRDKRALEVERTVSLAEV
YAGLPKDNGPFSLAQEIDKLVSQGSGSAGSGNNNLAFGAGTDTKTSLQASVSFADLKIRE
DYPASLGKIRRIKQISVTLPALLGPYQDVQAILSYGDKAGLANGCEALAVSHGMNDSGQF
QLDFNDGKFLPFEGIAIDQGTLTLSFPNASMPEKGKQATMLKTLNDIILHIRYTIK

Sequence of entity 2 (F), FASTA

>6SUF_2 TcdB2,TccC3 (chains F)
MQNSQDFSITELSLPKGGGAITGMGEALTPTGPDGMAALSLPLPISAGRGYAPAFTLNYN
SGAGNSPFGLGWDCNVMTIRRRTHFGVPHYDETDTFLGPEGEVLVVADQPRDESTLQGIN
LGATFTVTGYRSRLESHFSRLEYWQPKTTGKTDFWLIYSPDGQVHLLGKSPQARISNPSQ
TTQTAQWLLEASVSSRGEQIYYQYRAEDDTGCEADEITHHLQATAQRYLHIVYYGNRTAS
ETLPGLDGSAPSQADWLFYLVFDYGERSNNLKTPPAFSTTGSWLCRQDRFSRYEYGFEIR
TRRLCRQVLMYHHLQALDSKITEHNGPTLVSRLILNYDESAIASTLVFVRRVGHEQDGNV
VTLPPLELAYQDFSPRHHAHWQPMDVLANFNAIQRWQLVDLKGEGLPGLLYQDKGAWWYR
SAQRLGEIGSDAVTWEKMQPLSVIPSLQSNASLVDINGDGQLDWVITGPGLRGYHSQRPD
GSWTRFTPLNALPVEYTHPRAQLADLMGAGLSDLVLIGPKSVRLYANTRDGFAKGKDVVQ
SGEITLPVPGADPRKLVAFSDVLGSGQAHLVEVSATKVTCWPNLGRGRFGQPITLPGFSQ
PATEFNPAQVYLADLDGSGPTDLIYVHTNRLDIFLNKSGNGFAEPVTLRFPEGLRFDHTC
QLQMADVQGLGVASLILSVPHMSPHHWRCDLTNMKPWLLNEMNNNMGVHHTLRYRSSSQF
WLDEKAAALTTGQTPVCYLPFPIHTLWQTETEDEISGNKLVTTLRYARGAWDGREREFRG
FGYVEQTDSHQLAQGNAPERTPPALTKNWYATGLPVIDNALSTEYWRDDQAFAGFSPRFT
TWQDNKDVPLTPEDDNSRYWFNRALKGQLLRSELYGLDDSTNKHVPYTVTEFRSQVRRLQ
HTDSRYPVLWSSVVESRNYHYERIASDPQCSQNITLSSDRFGQPLKQLSVQYPRRQQPAI
NLYPDTLPDKLLANSYDDQQRQLRLTYQQSSWHHLTNNTVRVLGLPDSTRSDIFTYGAEN
VPAGGLNLELLSDKNSLIADDKPREYLGQQKTAYTDGQNTTPLQTPTRQALIAFTETTVF
NQSTLSAFNGSIPSDKLSTTLEQAGYQQTNYLFPRTGEDKVWVAHHGYTDYGTAAQFWRP
QKQSNTQLTGKITLIWDANYCVVVQTRDAAGLTTSAKYDWRFLTPVQLTDINDNQHLITL
DALGRPITLRFWGTENGKMTGYSSPEKASFSPPSDVNAAIELKKPLPVAQCQVYAPESWM
PVLSQKTFNRLAEQDWQKLYNARIITEDGRICTLAYRRWVQSQKAIPQLISLLNNGPRLP
PHSLTLTTDRYDHDPEQQIRQQVVFSDGFGRLLQAAARHEAGMARQRNEDGSLIINVQHT
ENRWAVTGRTEYDNKGQPIRTYQPYFLNDWRYVSNDSARQEKEAYADTHVYDPIGREIKV
ITAKGWFRRTLFTPWFTVNEDENDTAAEVKKVKMPGSRPMKNIDPKLYQKTPTVSVYDNR
GLIIRNIDFHRTTANGDPDTRITRHQYDIHGHLNQSIDPRLYEAKQTNNTIKPNFLWQYD
LTGNPLCTESIDAGRTVTLNDIEGRPLLTVTATGVIQTRQYETSSLPGRLLSVAEQTPEE
KTSRITERLIWAGNTEAEKDHNLAGQCVRHYDTAGVTRLESLSLTGTVLSQSSQLLIDTQ
EANWTGDNETVWQNMLADDIYTTLSTFDATGALLTQTDAKGNIQRLAYDVAGQLNGSWLT
LKGQTEQVIIKSLTYSAAGQKLREEHGNDVITEYSYEPETQRLIGIKTRRPSDTKVLQDL
RYEYDPVGNVISIRNDAEATRFWHNQKVMPENTYTYDSLYQLISATGREMANIGQQSHQF
PSPALPSDNNTYTNYTRTYTYDRGGNLTKIQHSSPATQNNYTTNITVSNRSNRAVLSTLT
EDPAQVDALFDAGGHQNTLISGQNLNWNTRGELQQVTLVKRDKGANDDREWYRYSGDGRR
MLKINEQQASNNAQTQRVTYLPNLELRLTQNSTATTEDLQVITVGEAGRAQVRVLHWESG
KPEDIDNNQLRYSYDNLIGSSQLELDSEGQIISEEEYYPYGGTALWAARNQTEASYKTIR
YSGKERDATGLYYYGYRYYQPWIGRWLSSDPAGTIDGLNLYRMVRNNPVTLLDPDGLMPT
IAERIAALKKNKVTDSAPSPANATNVAINIRPPVAPKPSLPKASTSSQPTTHPIGAANIK
PTTSGSSIVAPLSPVGNKSTSEISLPESAQSSSSSTTSTNLQKKSFTLYRADNRSFEEMQ
SKFPEGFKAWTPLDTKMARQFASIFIGQKDTSNLPKETVKNISTWGAKPKLKDLSNYIKY
TKDKSTVWVSTAINTEAGGQSSGAPLHKIDMDLYEFAIDGQKLNPLPEGRTKNMVPSLLL
DTPQIETSSIIALNHGPVNDAEISFLTTIPLKNVKPHKR

Primary citation

Structure of a Tc holotoxin pore provides insights into the translocation mechanism. Roderer, D., Hofnagel, O., Benz, R. et al. Proc Natl Acad Sci U S A (2019) 116:23083-23090. DOI 10.1073/pnas.1909821116 · PubMed

Other PDB entries of the same protein (UniProt Q9RN43), best resolution first:

6RW6 2.75 Å, Cryo-EM structure of Photorhabdus luminescens TcdA1
6L7I 2.9 Å, Signal substraction of TcdB1-TccC2 and part of TcdA1
8CPZ 2.9 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K1179W mutant
6L7E 3.2 Å, Toxin Complex TcdA1-TcdB1-TccC2
8CQ0 3.2 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K567W K2008W mutant
6SUE 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore, Mutation TccC3-D651A
5LKH 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state (obtained by flexible fitting)
5LKI 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state
4O9Y 3.5 Å, Crystal Structure of TcdA1
8CQ2 3.6 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, C16S, C20S, C870S, T1279C…
6H6F 3.72 Å, PTC3 holotoxin complex from Photorhabdus luminiscens - Mutant TcC-D651A
6H6E 3.95 Å, PTC3 holotoxin complex from Photorhabdus luminecens in prepore state (TcdA1, TcdB2, TccC3)

Browse structure collections

About this viewer

MolViewer shows 6SUF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.