6T36: PTPN3 PDZ domain

Crystal structure of the PTPN3 PDZ domain bound to the HBV core protein C-terminal peptide. Determined by X-ray diffraction at 1.86 Å resolution. Released 20 Jan 2021.

Method: X-ray diffraction
Resolution: 1.86 Å
Organisms: Homo sapiens, Hepatitis B virus
Chains: 2
Atoms: 880
Mol. weight: 128.6 kDa
Released: 20 Jan 2021

Explore 6T36 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6T36 contains 5 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	507-513	7	1
β-strand	523-528	6	1
α-helix	529-531	3
β-strand	533-540	8	1
α-helix	545-548	4
α-helix	552-553	2
α-helix	557	1
β-strand	558-562	5	1
β-strand	565-566	2	1
α-helix	572-581	10
β-strand	590-596	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5-7	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 3	A	protein	913	Homo sapiens	P26045 (AlphaFold model)
Capsid protein	B	protein	212	Hepatitis B virus	A8D6S6

Sequence of entity 1 (A), FASTA

>6T36_1 Tyrosine-protein phosphatase non-receptor type 3 (chains A)
MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHN
HLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQ
NEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
VAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDD
FHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCT
IAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS

Sequence of entity 2 (B), FASTA

>6T36_2 Capsid protein (chains B)
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLL
DTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNV
NMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRR
RGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC

Primary citation

Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein. Genera, M., Quioc-Salomon, B., Nourisson, A. et al. Sci Rep (2021) 11:944-944. DOI 10.1038/s41598-020-79580-9 · PubMed

Other PDB entries of the same protein (UniProt P26045 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RI5 1.26 Å, Crystal structure of PTPN3 (PTPH1) D811E mutant in complex with metavanadate
2B49 1.54 Å, Crystal Structure of the Catalytic Domain of Protein Tyrosine Phosphatase, non-receptor…
4RHG 1.58 Å, Crystal structure of PTPN3 (PTPH1) D811E, C842S mutant in complex with Eps15 pTyr849…
4RI4 1.6 Å, Crystal structure of PTPN3 (PTPH1) Y676I mutant in complex with vanadate
4RH9 1.6 Å, Crystal structure of PTPN3 (PTPH1) H812F, M883G mutant in complex with Eps15 pTyr849…
4RH5 1.6 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 peptide
8CQY 1.7 Å, Crystal structure of the PTPN3 PDZ domain bound to the PBM TACE C-terminal peptide
4S0G 1.72 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 P850V peptide
4QUN 1.86 Å, Crystal structure of the PTPN3 (PTPH1) catalytic domain C842S mutant
8OEP 1.87 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV18 E6 oncoprotein C-terminal…
6HKS 2.19 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal…
4QUM 2.52 Å, Crystal structure of PTPN3 (PTPH1) in complex with a dually phosphorylated MAPK12 peptide

Browse structure collections

About this viewer

MolViewer shows 6T36 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.