6TU7: PfMyoA decorated Plasmodium Act1 filament

Structure of PfMyoA decorated Plasmodium Act1 filament. Determined by electron microscopy at 3.1 Å resolution. Released 13 Jan 2021.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Plasmodium falciparum 3D7
Chains: 6
Atoms: 24,064
Mol. weight: 358.19 kDa
Ligands: 9UE, MG, ADP
Released: 13 Jan 2021

Explore 6TU7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TU7 contains 162 α-helices and 142 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AP1: 35 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	20-21	2
β-strand	35-38	4	1
β-strand	53-57	5	1
α-helix	58	1
β-strand	66-72	7	1
β-strand	80-82	3	1
β-strand	87-88	2	1
β-strand	101	1	2
α-helix	110-122	13
β-strand	128-130	3	2
β-strand	133-137	5	2
α-helix	148-156	9
α-helix	167-180	14
β-strand	185-191	7	2
α-helix	198-209	12
α-helix	219-225	7
α-helix	228-234	7
β-strand	236-237	2	3
β-strand	245-246	2	3
β-strand	249-256	8	2
β-strand	262-270	9	2
α-helix	275-277	3
β-strand	287	1	3
α-helix	288-296	9
α-helix	299-304	6
α-helix	310-312	3
α-helix	330-341	12
α-helix	346-362	17
β-strand	367-370	4	4
β-strand	378-381	4	4
α-helix	383-385	3
α-helix	386-394	9
α-helix	400-408	9
β-strand	409-413	5	5
β-strand	418-422	5	5
β-strand	424	1	4
α-helix	425-452	28
α-helix	453-455	3
β-strand	465-470	6	2
α-helix	481-511	31
α-helix	525-532	8
α-helix	538-547	10
α-helix	553-563	11
α-helix	564-566	3
β-strand	570-572	3	6
β-strand	580-585	6	6
β-strand	588-593	6	6
α-helix	597-601	5
α-helix	607-614	8
α-helix	619-624	6
β-strand	634	1	7
α-helix	641-658	18
β-strand	660-667	8	2
α-helix	680-689	10
α-helix	692-699	8
β-strand	705-707	3	8
α-helix	709-715	7
α-helix	731-742	12
α-helix	746-748	3
β-strand	749-751	3	8
β-strand	756-758	3	8
α-helix	760-766	7

Chains BP1 and EP1: 23 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
β-strand	9-13	5	9
β-strand	17-22	6	9
β-strand	23	1	10
β-strand	25	1	10
β-strand	30-33	4	9
β-strand	36-39	4	11
β-strand	43	1	12
β-strand	54-55	2	11
α-helix	58-61	4
β-strand	66-69	4	11
β-strand	72-73	2	13
β-strand	76-77	2	13
α-helix	80-88	9
α-helix	89-95	7
α-helix	99-101	3
β-strand	104-108	5	9
α-helix	114-126	13
β-strand	132-137	6	9
α-helix	138-144	7
β-strand	150-156	7	14
β-strand	161-167	7	14
β-strand	170-171	2	14
α-helix	173-175	3
β-strand	177-179	3	14
α-helix	183-193	11
α-helix	194-197	4
α-helix	207-217	11
α-helix	224-230	7
β-strand	239-242	4	15
β-strand	248-251	4	15
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	275-283	9
α-helix	291-294	4
β-strand	298-301	4	14
α-helix	310-319	10
β-strand	330-331	2	14
α-helix	339-348	10
α-helix	353-355	3
β-strand	358-359	2	9
α-helix	360-366	7
α-helix	368-370	3
α-helix	371-374	4

Chains CP1 and DP1: 23 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
β-strand	9-13	5	16
β-strand	17-22	6	16
β-strand	23	1	7
β-strand	25	1	7
β-strand	30-33	4	16
β-strand	36-39	4	17
β-strand	54-55	2	17
α-helix	58-61	4
β-strand	66-69	4	17
β-strand	72-73	2	18
β-strand	76-77	2	18
α-helix	80-88	9
α-helix	89-95	7
α-helix	99-101	3
β-strand	104-108	5	16
α-helix	114-126	13
β-strand	132-137	6	16
α-helix	138-144	7
β-strand	150-156	7	19
β-strand	161-167	7	19
β-strand	170-171	2	19
α-helix	173-175	3
β-strand	177-179	3	19
α-helix	183-193	11
α-helix	194-197	4
α-helix	207-217	11
α-helix	224-230	7
β-strand	239-242	4	20
β-strand	248-251	4	20
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	275-283	9
α-helix	291-294	4
β-strand	298-301	4	19
α-helix	310-319	10
β-strand	330-331	2	19
α-helix	339-348	10
α-helix	353-355	3
β-strand	358-359	2	16
α-helix	360-366	7
α-helix	368-370	3
α-helix	371-374	4

Chain GP1: 35 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	20-21	2
β-strand	35-38	4	32
β-strand	53-57	5	32
α-helix	58	1
β-strand	66-72	7	32
β-strand	80-82	3	32
β-strand	87-88	2	32
β-strand	101	1	33
α-helix	110-122	13
β-strand	128-130	3	33
β-strand	133-137	5	33
α-helix	148-156	9
α-helix	167-180	14
β-strand	185-191	7	33
α-helix	198-209	12
α-helix	219-224	6
α-helix	228-234	7
β-strand	236-237	2	34
β-strand	245-246	2	34
β-strand	249-256	8	33
β-strand	262-270	9	33
α-helix	275-277	3
β-strand	287	1	34
α-helix	288-296	9
α-helix	299-304	6
α-helix	310-312	3
α-helix	330-341	12
α-helix	346-362	17
β-strand	367-370	4	35
β-strand	378-381	4	35
α-helix	383-385	3
α-helix	386-394	9
α-helix	400-408	9
β-strand	409-413	5	36
β-strand	418-422	5	36
β-strand	424	1	35
α-helix	425-452	28
α-helix	453-455	3
β-strand	465-470	6	33
α-helix	481-511	31
α-helix	525-532	8
α-helix	538-547	10
α-helix	553-563	11
α-helix	564-566	3
β-strand	570-572	3	37
β-strand	580-585	6	37
β-strand	588-593	6	37
α-helix	597-601	5
α-helix	607-614	8
α-helix	619-624	6
β-strand	634	1	22
α-helix	641-658	18
β-strand	660-667	8	33
α-helix	680-689	10
α-helix	692-699	8
β-strand	705-707	3	38
α-helix	709-715	7
α-helix	731-742	12
α-helix	746-748	3
β-strand	749-751	3	38
β-strand	756-758	3	38
α-helix	760-766	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-A	AP1, GP1	protein	820	Plasmodium falciparum 3D7	Q8IDR3 (AlphaFold model)
Actin-1	BP1, CP1, DP1, EP1	protein	378	Plasmodium falciparum 3D7	Q8I4X0 (AlphaFold model)

Sequence of entity 1 (AP1, GP1), FASTA

>6TU7_1 Myosin-A (chains AP1, GP1)
GQFAVTNEEIKTASKIVRRVSNVEAFDKSGSVFKGYQIWTDISPTIENDPNIMFVKCVVQ
QGSKKEKLTVVQIDPPGTGTPYDIDPTHAWNCNSQVDPMSFGDIGLLNHTNIPCVLDFLK
HRYLKNQIYTTAVPLIVAINPYKDLGNTTNEWIRRYRDTADHTKLPPHVFTCAREALSNL
HGVNKSQTIIVSGESGAGKTEATKQIMRYFASSKSGNMDLRIQTAIMAANPVLEAFGNAK
TIRNNNSSRFGRFMQLVISHEGGIRYGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGAN
STMKSKFGLKGVTEYKLLNPNSTEVSGVDDVKDFEEVIESLKNMELSESDIEVIFSIVAG
ILTLGNVRLIEKQEAGLSDAAAIMDEDMGVFNKACELMYLDPELIKREILIKVTVAGGTK
IEGRWNKNDAEVLKSSLCKAMYEKLFLWIIRHLNSRIEPEGGFKTFMGMLDIFGFEVFKN
NSLEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTAELKYTSNKEVINVLCEKGKSV
LSYLEDQCLAPGGTDEKFVSSCATNLKENNKFTPAKVASNKNFIIQHTIGPIQYCAESFL
LKNKDVLRGDLVEVIKDSPNPIVQQLFEGQVIEKGKIAKGSLIGSQFLNQLTSLMNLINS
TEPHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFEEFLYQYKF
VDIAAAEDSSVENQNKCVNILKLSGLSESMYKIGKSMVFLKQEGAKILTKIQREKLVEWE
NCVSVIEAAILKHKYKQKVNKNIPSLLRVQAHIRKKMVAQ

Sequence of entity 2 (BP1, CP1, DP1, EP1), FASTA

>6TU7_2 Actin-1 (chains BP1, CP1, DP1, EP1)
GAMGEEDVQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPGIMVGMEEKDAFVGDE
AQTKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRE
RMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMR
LDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIE
KSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNI
VLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWI
TKEEYDESGPSIVHRKCF

Ligands and cofactors

ID	Name	Formula	Copies
9UE	Jasplakinolide	C36 H45 Br N4 O6	4
MG	Magnesium ion	Mg	4
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	4

Primary citation

High-resolution structures of malaria parasite actomyosin and actin filaments. Vahokoski, J., Calder, L.J., Lopez, A.J. et al. PLoS Pathog (2022) 18:e1010408-e1010408. DOI 10.1371/journal.ppat.1010408 · PubMed

Other PDB entries of the same protein (UniProt Q8IDR3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MZJ 1.47 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[801,805], a…
4MZK 1.82 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[807,811], a…
4AOM 1.94 Å, MTIP and MyoA complex
4R1E 1.98 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with a peptide-fragment…
4MZL 2.01 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with HBS myoA, a…
8A12 2.03 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to Mg.ATP-gamma-S
8CDQ 2.21 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
8CDM 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
9T7I 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state, complexed to the inhibitor…
6ZN3 2.51 Å, Plasmodium facliparum glideosome trimeric sub-complex
6YCY 2.55 Å, Plasmodium falciparum Myosin A full-length, post-rigor state
6I7D 2.82 Å, Plasmodium falciparum Myosin A, post-rigor and rigor-like states

Browse structure collections

About this viewer

MolViewer shows 6TU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.