6TZ9: Charged multivesicular body protein 1b

CryoEM reconstruction of membrane-bound ESCRT-III filament composed of CHMP1B only. Determined by electron microscopy at 6.2 Å resolution. Released 8 Apr 2020.

Method: Electron microscopy
Resolution: 6.2 Å
Organism: Homo sapiens
Chains: 26
Atoms: 32,890
Mol. weight: 575.65 kDa
Released: 8 Apr 2020

Explore 6TZ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TZ9 contains 104 α-helices and 0 β-strands across 26 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, AA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, V, W, X, Y and Z: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-40	38
α-helix	46-105	60
α-helix	108-139	32
α-helix	146-160	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Charged multivesicular body protein 1b	A, AA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, V, W, X, Y, Z	protein	199	Homo sapiens	Q7LBR1 (AlphaFold model)

Sequence of entity 1 (A, AA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, V, W, X, Y, Z), FASTA

>6TZ9_1 Charged multivesicular body protein 1b (chains A, AA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, V, W, X, Y, Z)
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIEKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV

Primary citation

Membrane constriction and thinning by sequential ESCRT-III polymerization. Nguyen, H.C., Talledge, N., McCullough, J. et al. Nat Struct Mol Biol (2020) 27:392-399. DOI 10.1038/s41594-020-0404-x · PubMed

Other PDB entries of the same protein (UniProt Q7LBR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TXR 1.0 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM and CHMP5 MIM
4TXQ 2.21 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM
3EAB 2.5 Å, Crystal structure of Spastin MIT in complex with ESCRT III
8V2S 2.72 Å, CHMP1B/IST1 dsDNA bound copolymer
6E8G 2.9 Å, CryoEM reconstruction of IST1-CHMP1B copolymer filament bound to ssDNA at 2.9 Angstrom…
8V2Q 2.95 Å, CHMP1B/IST1 ssRNA bound copolymer
8V2R 3.01 Å, CHMP1B/IST1 ssDNA bound copolymer
6TZ5 3.1 Å, CryoEM reconstruction of membrane-bound ESCRT-III filament composed of CHMP1B+IST1…
6TZ4 3.2 Å, CryoEM reconstruction of membrane-bound ESCRT-III filament composed of CHMP1B+IST1…
3JC1 4.0 Å, Electron cryo-microscopy of the IST1-CHMP1B ESCRT-III copolymer

Browse structure collections

About this viewer

MolViewer shows 6TZ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.