6E8G: IST1 homolog

CryoEM reconstruction of IST1-CHMP1B copolymer filament bound to ssDNA at 2.9 Angstrom resolution. Determined by electron microscopy at 2.9 Å resolution. Released 15 Aug 2018.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 72
Atoms: 97,272
Mol. weight: 2237.94 kDa
Released: 15 Aug 2018

Explore 6E8G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6E8G contains 468 α-helices and 0 β-strands across 72 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, BA, BB, C, DA, DB, E, FA, FB, G, HA, HB, I, JA, JB, K, LA, LB, M, NA, NB, O, PA, PB, Q, RA, RB, S, TA, TB, V, VA, X, XA, Z and ZA: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	8-46	39
α-helix	50-81	32
α-helix	83-88	6
α-helix	94-109	16
α-helix	116-127	12
α-helix	146-151	6
α-helix	156-158	3
α-helix	159-173	15

Chains AA, AB, B, CA, CB, D, EA, EB, F, GA, GB, H, IA, IB, J, KA, KB, L, MA, MB, N, OA, OB, P, QA, QB, R, SA, SB, T, UA, UB, W, WA, Y and YA: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	5-42	38
α-helix	45-105	61
α-helix	108-139	32
α-helix	146-160	15
α-helix	188-198	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IST1 homolog	A, BA, BB, C, DA, DB, E, FA, FB, G, HA, HB, I, JA, JB, K, LA, LB, M, NA, NB, O, PA, PB, Q, RA, RB, S, TA, TB, V, VA, X, XA, Z, ZA	protein	366	Homo sapiens	P53990 (AlphaFold model)
Charged multivesicular body protein 1b	AA, AB, B, CA, CB, D, EA, EB, F, GA, GB, H, IA, IB, J, KA, KB, L, MA, MB, N, OA, OB, P, QA, QB, R, SA, SB, T, UA, UB, W, WA, Y, YA	protein	199	Homo sapiens	Q7LBR1 (AlphaFold model)

Sequence of entity 1 (A, BA, BB, C, DA, DB, E, FA, FB, G, HA, HB, I, JA, JB, K, LA, LB, M, NA, NB, O, PA, PB, Q, RA, RB, S, TA, TB, V, VA, X, XA, Z, ZA), FASTA

>6E8G_1 IST1 homolog (chains A, BA, BB, C, DA, DB, E, FA, FB, G, HA, HB, I, JA, JB, K, LA, LB, M, NA, NB, O, PA, PB, Q, RA, RB, S, TA, TB, V, VA, X, XA, Z, ZA)
MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHII
REDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIV
ADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPD
SVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPS
ANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIV
GPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFE
ELKKKT

Sequence of entity 2 (AA, AB, B, CA, CB, D, EA, EB, F, GA, GB, H, IA, IB, J, KA, KB, L, MA, MB, N, OA, OB, P, QA, QB, R, SA, SB, T, UA, UB, W, WA, Y, YA), FASTA

>6E8G_2 Charged multivesicular body protein 1b (chains AA, AB, B, CA, CB, D, EA, EB, F, GA, GB, H, IA, IB, J, KA, KB, L, MA, MB, N, OA, OB, P, QA, QB, R, SA, SB, T, UA, UB, W, WA, Y, YA)
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIEKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV

Primary citation

The ESCRT-III proteins IST1 and CHMP1B assemble around nucleic acids. Talledge, N., McCullough, J., Wenzel, D.M. et al. bioRxiv (2018). DOI 10.1101/386532

Other PDB entries of the same protein (UniProt P53990 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S7J 1.15 Å, Structure of Human SPASTIN-IST1 complex.
4WZX 1.39 Å, ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins
4U7E 1.6 Å, The crystal structure of the complex of LIP5 NTD and IST1 MIM
4U7I 1.79 Å, Structure of the complex of Spartin MIT and IST1 MIM
3FRR 1.8 Å, Structure of human IST1(NTD) - (residues 1-189)(P21)
13GJ 2.0 Å, IST1 bound to PI(4,5)P2 containing membrane
4U7Y 2.5 Å, Structure of the complex of VPS4B MIT and IST1 MIM
13GH 2.56 Å, IST1 bound to PI(3,5)P2 containing membrane
3FRS 2.61 Å, Structure of human IST1(NTD) (residues 1-189)(p43212)
8UC6 2.7 Å, Calpain-7:IST1 Complex
8V2S 2.72 Å, CHMP1B/IST1 dsDNA bound copolymer
8V2Q 2.95 Å, CHMP1B/IST1 ssRNA bound copolymer

Browse structure collections

About this viewer

MolViewer shows 6E8G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.