3JC1: Increased Sodium Tolerance 1

Electron cryo-microscopy of the IST1-CHMP1B ESCRT-III copolymer. Determined by electron microscopy at 4.0 Å resolution. Released 16 Dec 2015.

Method: Electron microscopy
Resolution: 4.0 Å
Organism: Homo sapiens
Chains: 68
Atoms: 92,106
Mol. weight: 1321.66 kDa
Released: 16 Dec 2015

Explore 3JC1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JC1 contains 544 α-helices and 0 β-strands across 68 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains Aa, Ac, Ae, Ag, Ai, Ak, Am, Ao, Aq, As, Au, Aw, Ay, Ba, Bc, Be, Bg, Bi, Bk, Bm, Bo, Bq, Bs, Bu, Bw, By, Ca, Cc, Ce, Cg, Ci, Ck, Cm and Co: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	8-44	37
α-helix	49-81	33
α-helix	83-86	4
α-helix	99-105	7
α-helix	107-110	4
α-helix	116-125	10
α-helix	134-140	7
α-helix	146-152	7
α-helix	156-158	3
α-helix	159-172	14
α-helix	181-185	5

Chains Ab, Ad, Af, Ah, Aj, Al, An, Ap, Ar, At, Av, Ax, Az, Bb, Bd, Bf, Bh, Bj, Bl, Bn, Bp, Br, Bt, Bv, Bx, Bz, Cb, Cd, Cf, Ch, Cj, Cl, Cn and Cp: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	2-39	38
α-helix	44-101	58
α-helix	105-136	32
α-helix	138-140	3
α-helix	143-155	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Increased Sodium Tolerance 1 (IST1)	Aa, Ac, Ae, Ag, Ai, Ak, Am, Ao, Aq, As, Au, Aw, Ay, Ba, Bc, Be, Bg, Bi, Bk, Bm, Bo, Bq, Bs, Bu, Bw, By, Ca, Cc, Ce, Cg, Ci, Ck, Cm, Co	protein	182	Homo sapiens	P53990 (AlphaFold model)
Charged multivesicular body protein 1b	Ab, Ad, Af, Ah, Aj, Al, An, Ap, Ar, At, Av, Ax, Az, Bb, Bd, Bf, Bh, Bj, Bl, Bn, Bp, Br, Bt, Bv, Bx, Bz, Cb, Cd, Cf, Ch, Cj, Cl, Cn, Cp	protein	160	Homo sapiens	Q7LBR1 (AlphaFold model)

Sequence of entity 1 (Aa, Ac, Ae, Ag, Ai, Ak, Am, Ao, Aq, As, Au, Aw, Ay, Ba, Bc, Be, Bg, Bi, Bk, Bm, Bo, Bq, Bs, Bu, Bw, By, Ca, Cc, Ce, Cg, Ci, Ck, Cm, Co), FASTA

>3JC1_1 Increased Sodium Tolerance 1 (IST1) (chains Aa, Ac, Ae, Ag, Ai, Ak, Am, Ao, Aq, As, Au, Aw, Ay, Ba, Bc, Be, Bg, Bi, Bk, Bm, Bo, Bq, Bs, Bu, Bw, By, Ca, Cc, Ce, Cg, Ci, Ck, Cm, Co)
FKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYL
VEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLC
AKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMA
EA

Sequence of entity 2 (Ab, Ad, Af, Ah, Aj, Al, An, Ap, Ar, At, Av, Ax, Az, Bb, Bd, Bf, Bh, Bj, Bl, Bn, Bp, Br, Bt, Bv, Bx, Bz, Cb, Cd, Cf, Ch, Cj, Cl, Cn, Cp), FASTA

>3JC1_2 Charged multivesicular body protein 1b (chains Ab, Ad, Af, Ah, Aj, Al, An, Ap, Ar, At, Av, Ax, Az, Bb, Bd, Bf, Bh, Bj, Bl, Bn, Bp, Br, Bt, Bv, Bx, Bz, Cb, Cd, Cf, Ch, Cj, Cl, Cn, Cp)
MEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIEKAIQKGNMEVARIHAENAIRQKNQAV
NFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFE
TLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLD

Primary citation

Structure and membrane remodeling activity of ESCRT-III helical polymers. McCullough, J., Clippinger, A.K., Talledge, N. et al. Science (2015) 350:1548-1551. DOI 10.1126/science.aad8305 · PubMed

Other PDB entries of the same protein (UniProt P53990 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S7J 1.15 Å, Structure of Human SPASTIN-IST1 complex.
4WZX 1.39 Å, ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins
4U7E 1.6 Å, The crystal structure of the complex of LIP5 NTD and IST1 MIM
4U7I 1.79 Å, Structure of the complex of Spartin MIT and IST1 MIM
3FRR 1.8 Å, Structure of human IST1(NTD) - (residues 1-189)(P21)
13GJ 2.0 Å, IST1 bound to PI(4,5)P2 containing membrane
4U7Y 2.5 Å, Structure of the complex of VPS4B MIT and IST1 MIM
13GH 2.56 Å, IST1 bound to PI(3,5)P2 containing membrane
3FRS 2.61 Å, Structure of human IST1(NTD) (residues 1-189)(p43212)
8UC6 2.7 Å, Calpain-7:IST1 Complex
8V2S 2.72 Å, CHMP1B/IST1 dsDNA bound copolymer
6E8G 2.9 Å, CryoEM reconstruction of IST1-CHMP1B copolymer filament bound to ssDNA at 2.9 Angstrom…

Browse structure collections

About this viewer

MolViewer shows 3JC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.