8V2Q: CHMP1B/IST1 ssRNA bound copolymer

CHMP1B/IST1 ssRNA bound copolymer. Determined by electron microscopy at 2.95 Å resolution. Released 27 Nov 2024.

Method: Electron microscopy
Resolution: 2.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,916
Mol. weight: 61.9 kDa
Released: 27 Nov 2024

Explore 8V2Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8V2Q contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-41	39
α-helix	45-105	61
α-helix	108-139	32
α-helix	146-160	15
α-helix	187-198	12

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	8-45	38
α-helix	49-81	33
α-helix	83-88	6
α-helix	92-93	2
α-helix	94-110	17
α-helix	116-128	13
α-helix	130-137	8
α-helix	146-151	6
α-helix	156-158	3
α-helix	159-172	14
α-helix	181-186	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Charged multivesicular body protein 1b	A	protein	199	Homo sapiens	Q7LBR1 (AlphaFold model)
IST1 homolog	B	protein	364	Homo sapiens	P53990 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8V2Q_1 Charged multivesicular body protein 1b (chains A)
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTVSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV

Sequence of entity 2 (B), FASTA

>8V2Q_2 IST1 homolog (chains B)
MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHII
REDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIV
ADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPD
SVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSAN
TPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGP
GPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEEL
KKKT

Primary citation

ESCRT-III Assembles Around Mis-segregated DNA to Engage NoCut. Talledge, N., Glover, J., McCullough, J. et al. Nat Struct Mol Biol (2026). DOI 10.1038/s41594-026-01841-4

Other PDB entries of the same protein (UniProt Q7LBR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TXR 1.0 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM and CHMP5 MIM
4TXQ 2.21 Å, Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM
3EAB 2.5 Å, Crystal structure of Spastin MIT in complex with ESCRT III
8V2S 2.72 Å, CHMP1B/IST1 dsDNA bound copolymer
6E8G 2.9 Å, CryoEM reconstruction of IST1-CHMP1B copolymer filament bound to ssDNA at 2.9 Angstrom…
8V2R 3.01 Å, CHMP1B/IST1 ssDNA bound copolymer
6TZ5 3.1 Å, CryoEM reconstruction of membrane-bound ESCRT-III filament composed of CHMP1B+IST1…
6TZ4 3.2 Å, CryoEM reconstruction of membrane-bound ESCRT-III filament composed of CHMP1B+IST1…
3JC1 4.0 Å, Electron cryo-microscopy of the IST1-CHMP1B ESCRT-III copolymer
6TZ9 6.2 Å, CryoEM reconstruction of membrane-bound ESCRT-III filament composed of CHMP1B only

Browse structure collections

About this viewer

MolViewer shows 8V2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.