6U39: Calmodulin-1

2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 19 Feb 2020.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 20
Atoms: 11,377
Mol. weight: 210.99 kDa
Ligands: CA
Released: 19 Feb 2020

Explore 6U39 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6U39 contains 81 α-helices and 38 β-strands across 20 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-19	13
β-strand	26-27	2	1
α-helix	29-38	10
α-helix	49-55	7
β-strand	63-64	2	1
α-helix	65-74	10
α-helix	83-92	10
β-strand	100-101	2	2
α-helix	102-127	26
β-strand	135-136	2	3
α-helix	138-145	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1613-1632	20

Chain C: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	27	1	4
α-helix	29-38	10
α-helix	45-55	11
β-strand	63	1	4
α-helix	65-73	9
α-helix	83-92	10
β-strand	100-101	2	3
α-helix	102-127	26
β-strand	135-136	2	2
α-helix	138-145	8

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1612-1633	22

Chain E: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	5
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	5
α-helix	65-76	12
α-helix	84-92	9
β-strand	100-101	2	6
α-helix	102-128	27
β-strand	136	1	7
α-helix	138-145	8

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1615-1634	20

Chain G: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	8
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	8
α-helix	65-75	11
α-helix	86-92	7
β-strand	100	1	7
α-helix	102-127	26
β-strand	135-136	2	6
α-helix	138-145	8

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1613-1634	22

11 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin-1	A, C, E, G, I, K, M, O, Q, S	protein	148	Homo sapiens	P0DP23 (AlphaFold model)
Voltage-dependent L-type calcium channel subunit alpha-1C	B, D, F, H, J, L, N, P, R, T	protein	37	Homo sapiens	Q13936 (AlphaFold model)

Sequence of entity 1 (A, C, E, G, I, K, M, O, Q, S), FASTA

>6U39_1 Calmodulin-1 (chains A, C, E, G, I, K, M, O, Q, S)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE
VDEMIREAGIDGDGQVNYEEFVQMMTAK

Sequence of entity 2 (B, D, F, H, J, L, N, P, R, T), FASTA

>6U39_2 Voltage-dependent L-type calcium channel subunit alpha-1C (chains B, D, F, H, J, L, N, P, R, T)
SNADEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	29

Primary citation

Arrhythmia mutations in calmodulin can disrupt cooperativity of Ca2+binding and cause misfolding. Wang, K., Brohus, M., Holt, C. et al. J Physiol (2020) 598:1169-1186. DOI 10.1113/JP279307 · PubMed

Other PDB entries of the same protein (UniProt P0DP23 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MXD 1.17 Å, Human E104A calmodulin:MLCK RM20 complex
7BF1 1.24 Å, Ca2+-Calmodulin in complex with peptide from brain-type creatine kinase in extended 1:2…
6XXX 1.25 Å, 1.25 Angstrom crystal structure of Ca/CaM A102V:RyR2 peptide complex
4DJC 1.35 Å, 1.35 A crystal structure of the NaV1.5 DIII-IV-Ca/CaM complex
7BF2 1.43 Å, Ca2+-Calmodulin in complex with human muscle form creatine kinase peptide in extended…
2F3Y 1.45 Å, Calmodulin/IQ domain complex
2W73 1.45 Å, High-resolution structure of the complex between calmodulin and a peptide from…
4LZX 1.5 Å, Complex of IQCG and Ca2+-free CaM
5V03 1.58 Å, A positive allosteric modulator binding pocket in SK2 ion channels is shared by Riluzole…
9MVW 1.58 Å, Crystal structure of S101F calmodulin - CaM:RM20 analog complex
2F3Z 1.6 Å, Calmodulin/IQ-AA domain complex
6M7H 1.6 Å, Structure of calmodulin with KN93

Browse structure collections

About this viewer

MolViewer shows 6U39 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.