1.65 Angstrom crystal structure of the N97S Ca-CaM:CaV1.2 IQ domain complex. Determined by X-ray diffraction at 1.65 Å resolution. Released 19 Feb 2020.
Explore 6U3A in 3D Show helices and sheets RCSB PDB PDBe
6U3A contains 18 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-19 | 14 | |
| β-strand | 26-27 | 2 | 1 |
| α-helix | 29-38 | 10 | |
| α-helix | 45-55 | 11 | |
| β-strand | 63-64 | 2 | 1 |
| α-helix | 65-78 | 14 | |
| α-helix | 81-92 | 12 | |
| β-strand | 99-101 | 3 | 2 |
| α-helix | 102-112 | 11 | |
| α-helix | 118-128 | 11 | |
| β-strand | 135-137 | 3 | 2 |
| α-helix | 138-146 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-19 | 14 | |
| β-strand | 26-27 | 2 | 3 |
| α-helix | 29-38 | 10 | |
| α-helix | 45-55 | 11 | |
| β-strand | 63-64 | 2 | 3 |
| α-helix | 65-77 | 13 | |
| α-helix | 82-92 | 11 | |
| β-strand | 99-100 | 2 | 4 |
| α-helix | 102-111 | 10 | |
| α-helix | 118-128 | 11 | |
| β-strand | 136-137 | 2 | 4 |
| α-helix | 138-145 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1613-1636 | 24 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1618-1636 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calmodulin-1 | A, B | protein | 148 | Homo sapiens | P0DP23 (AlphaFold model) |
| Voltage-dependent L-type calcium channel subunit alpha-1C | C, D | protein | 37 | Homo sapiens | Q13936 (AlphaFold model) |
>6U3A_1 Calmodulin-1 (chains A, B) ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGSGYISAAELRHVMTNLGEKLTDEE VDEMIREADIDGDGQVNYEEFVQMMTAK
>6U3A_2 Voltage-dependent L-type calcium channel subunit alpha-1C (chains C, D) SNADEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPS
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 7 |
Water and common crystallization additives (NA) are not listed.
Arrhythmia mutations in calmodulin can disrupt cooperativity of Ca2+binding and cause misfolding. Wang, K., Brohus, M., Holt, C. et al. J Physiol (2020) 598:1169-1186. DOI 10.1113/JP279307 · PubMed
Other PDB entries of the same protein (UniProt P0DP23 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6U3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.