6UIB: IL23

Crystal structure of IL23 bound to peptide 23-652. Determined by X-ray diffraction at 2.74 Å resolution. Released 15 Jul 2020.

Method: X-ray diffraction
Resolution: 2.74 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 3,234
Mol. weight: 58.8 kDa
Released: 15 Jul 2020

Explore 6UIB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UIB contains 14 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	11-28	18
α-helix	54-56	3
α-helix	60-85	26
α-helix	101-116	16
α-helix	138-167	30

Chain B: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	1-5	5	1
β-strand	8-13	6	1
β-strand	22-27	6	2
β-strand	39-40	2	1
β-strand	52-57	6	2
α-helix	60-62	3
β-strand	64-67	4	1
β-strand	78-84	7	1
β-strand	85	1	3
β-strand	90	1	3
α-helix	96-97	2
β-strand	108-110	3	4
β-strand	111	1	5
β-strand	117-124	8	4
β-strand	130-138	9	1
α-helix	143	1
β-strand	144-145	2	1
β-strand	146-148	3	4
β-strand	152-156	5	4
β-strand	165-173	9	4
β-strand	186-194	9	1
β-strand	197-205	9	1
α-helix	207-210	4
β-strand	211	1	5
α-helix	213-216	4
β-strand	217-223	7	6
α-helix	224	1
β-strand	229-235	7	6
β-strand	249-255	7	7
β-strand	265-269	5	7
β-strand	273-277	5	6
β-strand	284-290	7	7
α-helix	296-300	5
β-strand	301-303	3	7

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	11-17	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-23 subunit alpha	A	protein	180	Homo sapiens	Q9NPF7 (AlphaFold model)
Interleukin-12 subunit beta	B	protein	316	Homo sapiens	P29460 (AlphaFold model)
Peptide 23-652	C	protein	20	synthetic construct

Sequence of entity 1 (A), FASTA

>6UIB_1 Interleukin-23 subunit alpha (chains A)
DRSLRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGD
GCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLL
QPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPHHHHHH

Sequence of entity 2 (B), FASTA

>6UIB_2 Interleukin-12 subunit beta (chains B)
DRSLIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQ
VKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSG
RFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSA
CPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEY
PDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSS
WSEWASVPCSHHHHHH

Sequence of entity 3 (C), FASTA

>6UIB_3 Peptide 23-652 (chains C)
DTLTKSFCYFGTWCQMYGST

Primary citation

Integration of phage and yeast display platforms: A reliable and cost effective approach for binning of peptides as displayed on-phage. Pandya, P., Sayers, R.O., Ting, J.P. et al. PLoS One (2020) 15:e0233961-e0233961. DOI 10.1371/journal.pone.0233961 · PubMed

Other PDB entries of the same protein (UniProt Q9NPF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MJ3 1.74 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 1
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
8CR8 2.0 Å, human Interleukin-23
3DUH 2.3 Å, Structure of Interleukin-23
8UUI 2.43 Å, X-ray structure of Interleukin-23 in complex with peptide 23-446
5MXA 2.5 Å, Structure of unbound Interleukin-23
4GRW 2.55 Å, Structure of a complex of human IL-23 with 3 Nanobodies (Llama vHHs)
5MZV 2.8 Å, IL-23:IL-23R:Nb22E11 complex
3D87 2.9 Å, Crystal structure of Interleukin-23
3QWR 3.25 Å, Crystal structure of IL-23 in complex with an adnectin
5MJ4 3.4 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 2
6WDQ 3.4 Å, IL23/IL23R/IL12Rb1 signaling complex

Browse structure collections

About this viewer

MolViewer shows 6UIB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.