6WW3: HERC2 ZZ domain

Crystal structure of HERC2 ZZ domain in complex with SUMO1 tail. Determined by X-ray diffraction at 2.1 Å resolution. Released 5 Aug 2020.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,091
Mol. weight: 14.28 kDa
Ligands: ZN
Released: 5 Aug 2020

Explore 6WW3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WW3 contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
β-strand	2702-2703	2	1
β-strand	2716-2717	2	1
β-strand	2720-2723	4	2
β-strand	2730-2731	2	2
α-helix	2733-2738	6
β-strand	2747-2750	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUMO1 linked HERC2 ZZ domain (Small ubiquitin-related modifier 1,E3 ubiquitin-protein ligase HERC2)	A, B	protein	60	Homo sapiens	O95714, P63165 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6WW3_1 SUMO1 linked HERC2 ZZ domain (Small ubiquitin-related modifier 1,E3 ubiquitin-protein ligase HERC2) (chains A, B)
SDQEAKIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Water and common crystallization additives (GOL, PEG) are not listed.

Primary citation

Structural Insight into Binding of the ZZ Domain of HERC2 to Histone H3 and SUMO1. Liu, J., Xue, Z., Zhang, Y. et al. Structure (2020) 28:1225-1230.e3. DOI 10.1016/j.str.2020.07.003 · PubMed

Other PDB entries of the same protein (UniProt O95714), best resolution first:

9L93 1.73 Å, Crystal structure of NCOA4 in complex with HERC2
3KCI 1.8 Å, The third RLD domain of HERC2
9L8Y 1.92 Å, Crystal structure of HERC2
7Q42 1.95 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
7RGW 1.99 Å, Crystal structure of HERC2 DOC domain
7Q45 2.1 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
7Q44 2.2 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
6WW4 2.25 Å, Crystal structure of HERC2 ZZ domain in complex with histone H3 tail
7Q40 2.35 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2
7Q43 2.4 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
7Q46 2.46 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
4L1M 2.6 Å, Structure of the first RCC1-like domain of HERC2

Browse structure collections

About this viewer

MolViewer shows 6WW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.