Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and LRRC7 inhibitory domain. Determined by X-ray diffraction at 1.85 Å resolution. Released 23 Dec 2020.
Explore 6X5G in 3D Show helices and sheets RCSB PDB PDBe
6X5G contains 19 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-12 | 5 | |
| β-strand | 13-21 | 9 | 1 |
| β-strand | 26-32 | 7 | 1 |
| α-helix | 33-35 | 3 | |
| β-strand | 37-45 | 9 | 1 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-66 | 16 | |
| β-strand | 72 | 1 | 2 |
| α-helix | 73-74 | 2 | |
| β-strand | 75-81 | 7 | 1 |
| β-strand | 84-89 | 6 | 1 |
| β-strand | 96 | 1 | 2 |
| α-helix | 97-104 | 8 | |
| α-helix | 109-128 | 20 | |
| β-strand | 131-132 | 2 | 3 |
| α-helix | 138-140 | 3 | |
| β-strand | 141-143 | 3 | 2 |
| α-helix | 150-151 | 2 | |
| β-strand | 152-154 | 3 | 2 |
| α-helix | 157-159 | 3 | |
| β-strand | 161-162 | 2 | 3 |
| β-strand | 169 | 1 | 4 |
| α-helix | 177-179 | 3 | |
| α-helix | 182-186 | 5 | |
| β-strand | 190 | 1 | 4 |
| α-helix | 193-208 | 16 | |
| α-helix | 218-227 | 10 | |
| α-helix | 236-239 | 4 | |
| α-helix | 242-251 | 10 | |
| α-helix | 260-261 | 2 | |
| α-helix | 262-266 | 5 | |
| α-helix | 269-272 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium/calmodulin-dependent protein kinase type II subunit alpha | A | protein | 268 | Homo sapiens | Q9UQM7 (AlphaFold model) |
| Leucine-rich repeat-containing protein 7 | B | protein | 22 | Homo sapiens | Q96NW7 (AlphaFold model) |
>6X5G_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains A) TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRL LKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHC HQMGVVHRNLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLR KDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKD LINKMLTINPSKRITAAEALKHPWISHR
>6X5G_2 Leucine-rich repeat-containing protein 7 (chains B) SKSRSTSSHGRRPLIRQDRIVG
| ID | Name | Formula | Copies |
|---|---|---|---|
| BCN | Bicine | C6 H13 N O4 | 1 |
Water and common crystallization additives (GOL) are not listed.
CaMKII binds both substrates and activators at the active site. Ozden, C., Sloutsky, R., Mitsugi, T. et al. Cell Rep (2022) 40:111064-111064. DOI 10.1016/j.celrep.2022.111064 · PubMed
Other PDB entries of the same protein (UniProt Q9UQM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6X5G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.