6XA6: Human Scribble PDZ3:Vangl2 Complex

Crystal Structure of Human Scribble PDZ3:Vangl2 Complex. Determined by X-ray diffraction at 1.95 Å resolution. Released 24 Mar 2021.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,398
Mol. weight: 22.07 kDa
Released: 24 Mar 2021

Explore 6XA6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XA6 contains 6 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1001-1008	8	1
β-strand	1016-1020	5	1
β-strand	1036-1041	6	1
α-helix	1046-1049	4
α-helix	1056	1
β-strand	1057-1061	5	1
β-strand	1064-1065	2	1
α-helix	1071-1079	9
β-strand	1084-1091	8	1

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	518-520	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scribble homolog	A, B	protein	96	Homo sapiens	Q14160 (AlphaFold model)
Vang-like protein 2	C, D	protein	8	Homo sapiens	Q9ULK5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6XA6_1 Protein scribble homolog (chains A, B)
GPLGSVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGD
RILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRD

Sequence of entity 2 (C, D), FASTA

>6XA6_2 Vang-like protein 2 (chains C, D)
RLQSETSV

Primary citation

Structural basis of the human Scribble-Vangl2 association in health and disease. How, J.Y., Stephens, R.K., Lim, K.Y.B. et al. Biochem J (2021) 478:1321-1332. DOI 10.1042/BCJ20200816 · PubMed

Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…

Browse structure collections

About this viewer

MolViewer shows 6XA6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.