6XA7: Human Scribble PDZ2:Vangl2 complex
Crystal Structure of Human Scribble PDZ2:Vangl2 complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 24 Mar 2021.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 2,949
- Mol. weight
- 43.21 kDa
- Released
- 24 Mar 2021
Explore 6XA7 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6XA7 contains 13 α-helices and 40 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 859-866 | 8 | 1 |
| β-strand | 874-878 | 5 | 1 |
| β-strand | 886 | 1 | 2 |
| β-strand | 889 | 1 | 2 |
| β-strand | 892-897 | 6 | 1 |
| β-strand | 898 | 1 | 3 |
| α-helix | 902-906 | 5 | |
| α-helix | 913 | 1 | |
| β-strand | 914-918 | 5 | 1 |
| β-strand | 921-922 | 2 | 1 |
| α-helix | 928-936 | 9 | |
| β-strand | 941-948 | 8 | 1 |
Chain B: 5 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 856 | 1 | 4 |
| β-strand | 858 | 1 | 4 |
| β-strand | 859-866 | 8 | 5 |
| α-helix | 867-868 | 2 | |
| β-strand | 874-878 | 5 | 5 |
| β-strand | 880 | 1 | 6 |
| α-helix | 883-884 | 2 | |
| β-strand | 886 | 1 | 7 |
| β-strand | 889 | 1 | 7 |
| β-strand | 892-897 | 6 | 5 |
| β-strand | 898 | 1 | 3 |
| α-helix | 902-906 | 5 | |
| β-strand | 914-918 | 5 | 5 |
| β-strand | 921-922 | 2 | 5 |
| α-helix | 923-925 | 3 | |
| β-strand | 927 | 1 | 6 |
| α-helix | 928-935 | 8 | |
| β-strand | 941-948 | 8 | 5 |
Chain C: 2 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 859-866 | 8 | 8 |
| β-strand | 874-877 | 4 | 8 |
| β-strand | 886 | 1 | 9 |
| β-strand | 889 | 1 | 9 |
| β-strand | 893-897 | 5 | 8 |
| α-helix | 902-906 | 5 | |
| β-strand | 914-918 | 5 | 8 |
| β-strand | 921-922 | 2 | 8 |
| α-helix | 928-936 | 9 | |
| β-strand | 941-948 | 8 | 8 |
Chain D: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 860-865 | 6 | 10 |
| α-helix | 866-868 | 3 | |
| β-strand | 874-878 | 5 | 10 |
| β-strand | 892-897 | 6 | 10 |
| α-helix | 902-906 | 5 | |
| β-strand | 914-918 | 5 | 10 |
| β-strand | 921-922 | 2 | 10 |
| α-helix | 928-936 | 9 | |
| β-strand | 942-947 | 6 | 10 |
Chains E, G and H: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 518-520 | 3 | 1 |
Chain F: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 519-520 | 2 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein scribble homolog | A, B, C, D | protein | 96 | Homo sapiens | Q14160 (AlphaFold model) |
| Vang-like protein 2 | E, F, G, H | protein | 8 | Homo sapiens | Q9ULK5 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>6XA7_1 Protein scribble homolog (chains A, B, C, D)
GPLGSRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRAGTLQVGDR
VLSINGVDVTEARHDHAVSLLTAASPTIALLLEREA
Sequence of entity 2 (E, F, G, H), FASTA
>6XA7_2 Vang-like protein 2 (chains E, F, G, H)
RLQSETSV
Primary citation
Structural basis of the human Scribble-Vangl2 association in health and disease. How, J.Y., Stephens, R.K., Lim, K.Y.B. et al. Biochem J (2021) 478:1321-1332. DOI 10.1042/BCJ20200816 · PubMed
Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
- 6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
- 2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
- 6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
- 6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
- 5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
- 7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
- 7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
- 7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
- 7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
- 7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
- 7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…
Browse structure collections
About this viewer
MolViewer shows 6XA7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.