6Y2C: Third KH domain of FUBP1

Crystal structure of the third KH domain of FUBP1. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Mar 2020.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,256
Mol. weight: 21.06 kDa
Ligands: ZN
Released: 25 Mar 2020

Explore 6Y2C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Y2C contains 13 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	278-283	6	1
α-helix	284-286	3
α-helix	287-291	5
α-helix	293-295	3
α-helix	296-305	10
β-strand	308-311	4	1
α-helix	312-313	2
β-strand	320-326	7	1
α-helix	329-345	17

Chain B: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	261-266	6
β-strand	277-283	7	2
α-helix	284-286	3
α-helix	287-291	5
α-helix	293-295	3
α-helix	296-305	10
β-strand	308-311	4	2
α-helix	312-314	3
β-strand	320-326	7	2
α-helix	329-345	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Far upstream element-binding protein 1	A, B	protein	93	Homo sapiens	Q96AE4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6Y2C_1 Far upstream element-binding protein 1 (chains A, B)
SMFREVRNEYGSRIGGNEGIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTT
PERIAQITGPPDRCQHAAEIITDLLRSVQAGNP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Water and common crystallization additives (EDO) are not listed.

Primary citation

Comparative structural analyses and nucleotide-binding characterization of the four KH domains of FUBP1. Ni, X., Knapp, S., Chaikuad, A. Sci Rep (2020) 10:13459-13459. DOI 10.1038/s41598-020-69832-z · PubMed

Other PDB entries of the same protein (UniProt Q96AE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LIJ 1.8 Å, Crystal structure of a far upstream element (FUSE) binding protein 1 (FUBP1) from Homo…
6Y24 1.86 Å, Crystal structure of fourth KH domain of FUBP1
6Y2D 1.9 Å, Crystal structure of the second KH domain of FUBP1
1J4W Complex of the KH3 and KH4 domains of fbp with a single_stranded 29mer DNA…
2KXH Solution structure of the first two RRM domains of FIR in the complex with FBP Nbox…
8P25 Solution structure of a chimeric U2AF2 RRM2 / FUBP1 N-Box

Browse structure collections

About this viewer

MolViewer shows 6Y2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.